NOXA1 Antibody

Images

 
Western Blot: NOXA1 Antibody [NBP1-92197] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: NOXA1 Antibody [NBP1-92197] - Staining of human cell line HaCaT shows localization to vesicles.
Immunohistochemistry-Paraffin: NOXA1 Antibody [NBP1-92197] - Staining of human kidney shows strong cytoplasmic and membranous positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOXA1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOXA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
NOXA1 Protein (NBP1-92197PEP)
Publications
Read Publication using
NBP1-92197 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOXA1 Antibody

  • Antigen NY-CO-31
  • FLJ25475
  • inhibitory NADPH oxidase activator 1
  • MGC131800
  • NADPH oxidase activator 1
  • NCF2-like protein
  • NOX activator 1
  • NY-CO-31
  • p51NOX
  • p51-nox
  • P67phox-like factor
  • SDCCAG31
  • serologically defined colon cancer antigen 31

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-950
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-31546
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-41291
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-790
Species: Hu, Mu, Po
Applications: WB, IHC-P, PEP-ELISA
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82542
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40974
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IP
AF3795
Species: Hu
Applications: WB, IP
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5758
Species: Hu
Applications: WB, IHC, ICC
AF5675
Species: Hu, Mu, Rt
Applications: WB, IHC
MAB1904
Species: Hu
Applications: WB, IHC, ICC
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-22377
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33463
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NOXA1 Antibody (NBP1-92197)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for NOXA1 Antibody (NBP1-92197) (0)

There are no reviews for NOXA1 Antibody (NBP1-92197). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NOXA1 Antibody (NBP1-92197) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOXA1 Products

Bioinformatics Tool for NOXA1 Antibody (NBP1-92197)

Discover related pathways, diseases and genes to NOXA1 Antibody (NBP1-92197). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOXA1 Antibody (NBP1-92197)

Discover more about diseases related to NOXA1 Antibody (NBP1-92197).
 

Pathways for NOXA1 Antibody (NBP1-92197)

View related products by pathway.

PTMs for NOXA1 Antibody (NBP1-92197)

Learn more about PTMs related to NOXA1 Antibody (NBP1-92197).

Blogs on NOXA1

There are no specific blogs for NOXA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOXA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOXA1