NOXA1 Antibody

Product Discontinued

NOXA1 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EGSLNGLDSALDQVQRRGSLPPRQVPRGEVFRPHRWHLKHLEPVDFLGKAKVVASAIPDDQGWGVRPQQPQGPGANHDARSLIMDSPR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOXA1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NOXA1 Antibody

• Antigen NY-CO-31
• FLJ25475
• inhibitory NADPH oxidase activator 1
• MGC131800
• NADPH oxidase activator 1
• NCF2-like protein
• NOX activator 1
• NY-CO-31
• p51NOX
• p51-nox
• P67phox-like factor
• SDCCAG31
• serologically defined colon cancer antigen 31

Background

NADPH oxidases (NOXs) catalyze the transfer of electrons from NADPH to molecular oxygen to generate reactive oxygen species (ROS). The NOX activator NOXA1 can stimulate both NOX1 (MIM 300225) and NOX2 (CYBB; MIM 300481), but it appears to be more effective in activating NOX1 (Opitz et al., 2007 [PubMed 17189823]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NOXA1 Antibody (NBP1-92197)(1)

Publication using NBP1-92197

• Gascard P, Bilenky M, Sigaroudinia M et al. Epigenetic and transcriptional determinants of the human breast. Nat Commun. 2015-02-18 [PMID: 25690954] (IHC-P, Human)

Bioinformatics

• Gene Symbol: NOXA1