Nova1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Nova1 Antibody [NBP1-86517] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoli.

Immunohistochemistry-Paraffin: Nova1 Antibody [NBP1-86517] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.

Analysis in control (vector only transfected HEK293T lysate) and NOVA1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Nova1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Nova1 Antibody - BSA Free (NBP1-86517) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Nova1 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NLNTLGLGLSQAAATGALAAAAASANPAAAAANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKSTDGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARI
• Predicted Species: Mouse (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NOVA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Nova1 Recombinant Protein Antigen (NBP1-86517PEP)

Reactivity Notes

Use in Rat reported in scientific literature (PMID:33799408).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Nova1 Antibody - BSA Free

• neuro-oncological ventral antigen 1Nova-1
• Onconeural ventral antigen 1
• Paraneoplastic Ri antigen
• RNA-binding protein Nova-1
• Ventral neuron-specific protein 1

Background

Nova1 encodes a neuron-specific RNA-binding protein, a member of the Nova family of paraneoplastic disease antigens, that is recognized and inhibited by paraneoplastic antibodies. These antibodies are found in the sera of patients with paraneoplastic opsoclonus-ataxia, breast cancer, and small cell lung cancer. Alternatively spliced transcripts encoding distinct isoforms have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Nova1 Antibody (NBP1-86517)(2)

Publications using NBP1-86517

• Liu Z, Lou Y, Cui J et al. Circular RNA UVRAG Mediated by Alternative Splicing Factor NOVA1 Regulates Adhesion and Migration of Vascular Smooth Muscle Cells Genes 2021-03-14 [PMID: 33799408] (ICC/IF, Rat)
• Li H, Sun C, Wang Y et al. Dynamic Expression Pattern of Neuro-oncological Ventral Antigen 1 (Nova1) in the Rat Brain after Focal Cerebral Ischemia/Reperfusion Insults. J Histochem Cytochem 2013-01-01 [PMID: 23042482]

Bioinformatics

• Gene Symbol: NOVA1