NONO Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NONO. Source: E. coli
Amino Acid Sequence: PTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
NONO |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38727. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
22 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for NONO Recombinant Protein Antigen
Background
Non-POU-domain-containing octamer binding protein (NONO) is a member of the DBHS (drosophila behavior, human splicing) domain-containing family and is an RNA- and DNA- binding protein. NONO and other DBHS domain-containing proteins are multifunctional and are reported to be involved in transcriptional regulation, mRNA processing, and DNA non-homologous end joining (NHEJ). NONO functions as a coregulator of the androgen receptor (AR) and also regulates cAMP transcriptional activity by interacting with gene promoter elements. NONO is also involved in pre-mRNA splicing through an interaction with U5 snRNA and can stimulate DNA nonhomologous end joining (NHEJ) through the interaction with ku70/G22p and ku80/XRCC5 dimers. Alternate names for NONO include 54 kDa nuclear RNA- and DNA-binding protein, p54 (nrb), 55 kDa nuclear protein, NMT55, DNA-binding p52/p100 complex, NRB54, P54, and P54NRB.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Ha, Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Publications for NONO Protein (NBP2-38727PEP) (0)
There are no publications for NONO Protein (NBP2-38727PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NONO Protein (NBP2-38727PEP) (0)
There are no reviews for NONO Protein (NBP2-38727PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for NONO Protein (NBP2-38727PEP) (0)
Additional NONO Products
Research Areas for NONO Protein (NBP2-38727PEP)
Find related products by research area.
|
Blogs on NONO