Recombinant Human NONO Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NONO Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 101 - 210 of Human NONO partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE

Protein/Peptide Type
Partial Recombinant Protein
Gene
NONO

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA.Use in Immunoprecipitation reported in scientific literature (PMID 23955554) This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00004841-Q01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NONO Protein

  • NMT5552 kDa subunit
  • non-POU domain containing, octamer-binding
  • NRB54non-POU-domain-containing, octamer-binding
  • p54(nrb)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-61045
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1334
Species: Hu
Applications: WB, IHC
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-83801
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00080122-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP1-92392
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00004841-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NONO Partial Recombinant Protein (H00004841-Q01)(1)

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
All Species

Reviews for NONO Partial Recombinant Protein (H00004841-Q01) (0)

There are no reviews for NONO Partial Recombinant Protein (H00004841-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NONO Partial Recombinant Protein (H00004841-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NONO Products

Bioinformatics Tool for NONO Partial Recombinant Protein (H00004841-Q01)

Discover related pathways, diseases and genes to NONO Partial Recombinant Protein (H00004841-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NONO Partial Recombinant Protein (H00004841-Q01)

Discover more about diseases related to NONO Partial Recombinant Protein (H00004841-Q01).
 

Pathways for NONO Partial Recombinant Protein (H00004841-Q01)

View related products by pathway.

PTMs for NONO Partial Recombinant Protein (H00004841-Q01)

Learn more about PTMs related to NONO Partial Recombinant Protein (H00004841-Q01).
 

Research Areas for NONO Partial Recombinant Protein (H00004841-Q01)

Find related products by research area.

Blogs on NONO

There are no specific blogs for NONO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NONO Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NONO