Recombinant Human NOMO3 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NOMO3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 966-1033 of Human NOMO3

Source: Wheat Germ

Amino Acid Sequence: TVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKAEGNDHIERALPHH

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
NOMO3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
33.22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NOMO3 Protein

  • NODAL modulator 3
  • Nomo
  • pM5 protein 3
  • pM5 protein, middle copy

Background

This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a duplicated region on the short arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81002
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-77269
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
NBP1-32112
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3755
Species: Hu
Applications: WB
AF746
Species: Hu, Mu
Applications: WB
NBP2-12553
Species: Hu
NBP2-24611
Species: Hu, Mu, Rt, Bv, Ca, Eq, Op
Applications: WB
H00001846-M08
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-74360
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80789
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-85517
Species: Hu
Applications: IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00408050-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for NOMO3 Partial Recombinant Protein (H00408050-Q01) (0)

There are no publications for NOMO3 Partial Recombinant Protein (H00408050-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NOMO3 Partial Recombinant Protein (H00408050-Q01) (0)

There are no reviews for NOMO3 Partial Recombinant Protein (H00408050-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NOMO3 Partial Recombinant Protein (H00408050-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for NOMO3 Partial Recombinant Protein (H00408050-Q01)

Discover related pathways, diseases and genes to NOMO3 Partial Recombinant Protein (H00408050-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOMO3 Partial Recombinant Protein (H00408050-Q01)

Discover more about diseases related to NOMO3 Partial Recombinant Protein (H00408050-Q01).
 

Pathways for NOMO3 Partial Recombinant Protein (H00408050-Q01)

View related products by pathway.

PTMs for NOMO3 Partial Recombinant Protein (H00408050-Q01)

Learn more about PTMs related to NOMO3 Partial Recombinant Protein (H00408050-Q01).

Blogs on NOMO3

There are no specific blogs for NOMO3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SMAD6 Antibody
NB100-56440

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NOMO3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NOMO3