NOB1 Antibody

Images

 
Immunohistochemistry-Paraffin: NOB1 Antibody [NBP2-13663] - Staining of human ovary shows nuclear positivity in ovarian stroma cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NOB1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSNIKQIQQELEQCDVPEDVRVGCLTTDFAMQNVLLQMGLHVLAVNGMLI REARSYILRCHGCFKTTSDMSRVFCSHCGNKTLKKVSVTVSDDGTLHMHF SR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NOB1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NOB1 Protein (NBP2-13663PEP)
Publications
Read Publication using NBP2-13663.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NOB1 Antibody

  • adenocarcinoma antigen recognized by T lymphocytes 4
  • ART4
  • ART-4
  • MST158
  • nin one binding protein
  • NIN1/RPN12 binding protein 1 homolog (S. cerevisiae)
  • NOB1PPSMD8BP1
  • Phosphorylation regulatory protein HP-10
  • Protein ART-4
  • PSMD8 binding protein 1
  • RNA-binding protein NOB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000419-D01P
Species: Hu, Mu
Applications: WB
NB100-65853
Species: Mu
Applications: Flow, IP
NBP1-87282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-83254
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87962
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00006193-M02
Species: Hu, Mu, Rt, Pr
Applications: WB, ELISA, ICC/IF
H00056902-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00054957-B02P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87469
Species: Hu
Applications: IHC, IHC-P
NBP2-45960
Species: Hu, Mu, Mk
Applications: WB, IHC, IF
NBP2-38152
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86734
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58953
Species: Hu
Applications: ICC/IF
NBP2-30659
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-13663
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for NOB1 Antibody (NBP2-13663)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for NOB1 Antibody (NBP2-13663) (0)

There are no reviews for NOB1 Antibody (NBP2-13663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NOB1 Antibody (NBP2-13663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NOB1 Products

Bioinformatics Tool for NOB1 Antibody (NBP2-13663)

Discover related pathways, diseases and genes to NOB1 Antibody (NBP2-13663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NOB1 Antibody (NBP2-13663)

Discover more about diseases related to NOB1 Antibody (NBP2-13663).
 

Pathways for NOB1 Antibody (NBP2-13663)

View related products by pathway.

PTMs for NOB1 Antibody (NBP2-13663)

Learn more about PTMs related to NOB1 Antibody (NBP2-13663).

Blogs on NOB1

There are no specific blogs for NOB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NOB1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NOB1