TJAP1 Antibody

Western Blot: TJAP1 Antibody [NBP2-38152] - Analysis in control (vector only transfected HEK293T lysate) and TJAP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: TJAP1 Antibody [NBP2-38152] - Immunofluorescent staining of human cell line A-431 shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: TJAP1 Antibody [NBP2-38152] - Staining of human placenta shows strong cytoplasmic positivity with a granular pattern in trophoblastic cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

TJAP1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SASSEEDLLVSWQRAFVDRTPPPAAVAQRTAFGRDALPELQRHFAHSPADRDEVVQAPSARPEESELLLPTEP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TJAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TJAP1 Protein (NBP2-38152PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TJAP1 Antibody

• DKFZp686F06131
• PILTTJP4tight junction protein 4 (peripheral)
• Protein incorporated later into tight junctions
• tight junction associated protein 1 (peripheral)
• Tight junction protein 4
• tight junction-associated protein 1

Background

The TJAP1 gene encodes a tight junction-associated protein. Incorporation of the encoded protein into tight junctions occursat a late stage of formation of the junctions. The encoded protein localizes to the Golgi and may function in vesicletrafficking. Altern

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TJAP1
• Uniprot:
  • Q5JTD0(Human)