NME6 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit NME6 Antibody - BSA Free (NBP1-81587) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: DAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA |
| Predicted Species |
Rat (90%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NME6 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for NME6 Antibody - BSA Free
Background
Belonging to the NDK family, NME6 plays an important role in cell growth and is commonly expressed in the kidney, prostate, ovary and intestine. This gene is an inhibitor of p53 induced apoptosis and is a ubiquitous enzyme that catalyzes the transfer of gamma-phosphates. NME6 also phosphorylates nucleoside diphosphates; and is involved in the regulation of development, oncogenic transformation and metastasis. It also plays a major role in the synthesis of nucleoside triphosphates other than ATP. Molecular functions include ATP binding, kinase activity, metal ion binding, nucleoside diphosphate kinase activity, nucleotide binding and transferase activity. Diseases for NME6 include neisseria meningitides, prostatitis, prostate cancer and pneumonia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Hu
Applications: Block, IHC, WB
Species: Hu
Applications: ELISA, S-ELISA, WB
Species: Mu
Applications: ChIP, ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ICC/IF, IHC
Publications for NME6 Antibody (NBP1-81587) (0)
There are no publications for NME6 Antibody (NBP1-81587).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NME6 Antibody (NBP1-81587) (0)
There are no reviews for NME6 Antibody (NBP1-81587).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NME6 Antibody (NBP1-81587) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NME6 Products
Research Areas for NME6 Antibody (NBP1-81587)
Find related products by research area.
|
Blogs on NME6