NME6 Antibody

Images

 
Western Blot: NME6 Antibody [NBP1-81587] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-388
Immunocytochemistry/ Immunofluorescence: NME6 Antibody [NBP1-81587] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: NME6 Antibody [NBP1-81587] - Staining of human bronchus shows strong cytoplasmic positivity in endothelial cells and respiratory epithelial cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NME6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DAIQLWRTLMGPTRVFRARHVAPDSIRGSFGLTDTRNTTHGSDSVVSASREIAAFFPDFSEQRWYEEEEPQLRCGPVCYSPEGGVHYVAGTGGLGPA
Specificity
Specificity of human NME6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NME6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NME6 Antibody

  • EC 2.7.4.6
  • Inhibitor of p53-induced apoptosis-alpha
  • IPIA-ALPHA
  • NDK 6
  • NDP kinase 6
  • NM23-H6
  • non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase)
  • nucleoside diphosphate kinase 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83482
Species: Hu
Applications: WB, IHC, IHC-P
H00004830-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-02487
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00004831-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
NB300-516
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, Flow, ICC/IF, IHC
NBP1-83234
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00388112-B01P
Species: Hu
Applications: WB, ELISA
AF1997
Species: Hu
Applications: WB, ChIP, ICC
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP1-31093
Species: Hu
Applications: WB
AF3158
Species: Mu
Applications: WB, ChIP, ICC
H00006102-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for NME6 Antibody (NBP1-81587) (0)

There are no publications for NME6 Antibody (NBP1-81587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NME6 Antibody (NBP1-81587) (0)

There are no reviews for NME6 Antibody (NBP1-81587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NME6 Antibody (NBP1-81587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NME6 Products

Bioinformatics Tool for NME6 Antibody (NBP1-81587)

Discover related pathways, diseases and genes to NME6 Antibody (NBP1-81587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NME6 Antibody (NBP1-81587)

Discover more about diseases related to NME6 Antibody (NBP1-81587).
 

Pathways for NME6 Antibody (NBP1-81587)

View related products by pathway.

PTMs for NME6 Antibody (NBP1-81587)

Learn more about PTMs related to NME6 Antibody (NBP1-81587).
 

Research Areas for NME6 Antibody (NBP1-81587)

Find related products by research area.

Blogs on NME6

There are no specific blogs for NME6, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NME6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NME6
Novus 100% Guarantee