NKX2.3 Antibody (4F4) - Azide and BSA Free

Western Blot: NKX2.3 Antibody (4F4) [H00159296-M02] - detection against Immunogen (31.9 KDa).

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4F4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NKX2.3 Antibody (4F4) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse NKX2.3 Antibody (4F4) - Azide and BSA Free (H00159296-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: NKX2-3 (NP_660328.1, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFS
• Specificity: NKX2-3 - NK2 transcription factor related, locus 3 (Drosophila) (4F4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: NKX2-3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NKX2.3 Antibody (4F4) - Azide and BSA Free

• CSX3NK2.3
• Homeobox protein NK-2 homolog C
• homeobox protein Nkx-2.3
• NK2 transcription factor related, locus 3 (Drosophila)
• NKX2.3
• NKX23
• NKX2CNK-2 (Drosophila) homolog C
• NKX4-3

Background

NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NKX2-3
• Entrez:
  • 159296(Human)
• Uniprot:
  • NP_660328(Human)