NKCC2/SLC12A1 Antibody (4H4) - Azide and BSA Free

Western Blot: NKCC2/SLC12A1 Antibody (4H4) [H00006557-M03] - Analysis of SLC12A1 expression in transfected 293T cell line by SLC12A1 monoclonal antibody (M03), clone 4H4. Lane 1: SLC12A1 transfected lysatE (46.5 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4H4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

NKCC2/SLC12A1 Antibody (4H4) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: SLC12A1 (NP_000329.1, 80 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AKTDASFHAYDSHTNTYYLQTFGHNTMDAVPKIEYYRNTGSISGPKVNRPSLLEIHEQLAKNVAVTPSSADRVANGDGIPGDEQAENKEDDQA
• Specificity: SLC12A1 - solute carrier family 12 (sodium/potassium/chloride transporters), member 1 (4H4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SLC12A1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NKCC2/SLC12A1 Antibody (4H4) - Azide and BSA Free

• BSC1
• Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2
• Kidney-specific Na-K-Cl symporter
• MGC48843
• NKCC2
• NKCC2A variant A
• NKCC2Na-K-2Cl cotransporter
• SLC12A1
• solute carrier family 12 (sodium/potassium/chloride transporters), member 1
• solute carrier family 12 member 1

Background

The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC12A1
• Entrez:
  • 6557(Human)
• Uniprot:
  • NP_000329()