Recombinant Human NKCC1/SLC12A2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NKCC1/SLC12A2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 903-1010 of Human SLC12A2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:YINLFHDAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKVEEEDGKTATQPLLKKESKGPIVPLNVADQKLLE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC12A2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NKCC1/SLC12A2 Protein

  • Basolateral Na-K-Cl symporter
  • BSC
  • BSC2
  • Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1
  • NKCC1
  • NKCC1MGC104233
  • SLC12A2
  • solute carrier family 12 (sodium/potassium/chloride transporters), member 2
  • solute carrier family 12 member 2

Background

By moving chloride into epithelial cells, the Na-K-Cl cotransporter SLC12A2 aids transcellular movement of chloride across both secretory and absorptive epithelia (Payne et al., 1995 [PubMed 7629105]). See also SLC12A1 (MIM 600839) and SLC12A3 (MIM 600968). [supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57622
Species: Hu
Applications: WB, IHC, IHC-P
MAB8369
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-48021
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86376
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83067
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009943-M16
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-91725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82492
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-284
Species: Hu, Mu, Rt
Applications: ICC/IF (-), WB, EM, IHC, IHC-Fr, IHC-P
NBP1-89282
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-85133
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB110-81529
Species: Hu, Mu, Rt, Op, Pm, Rb
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IP, IF
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-90225
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00006558-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01) (0)

There are no publications for NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01) (0)

There are no reviews for NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NKCC1/SLC12A2 Products

Bioinformatics Tool for NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01)

Discover related pathways, diseases and genes to NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01)

Discover more about diseases related to NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01).
 

Pathways for NKCC1/SLC12A2 Partial Recombinant Protein (H00006558-Q01)

View related products by pathway.

Blogs on NKCC1/SLC12A2

There are no specific blogs for NKCC1/SLC12A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NKCC1/SLC12A2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC12A2
Entrez