Recombinant Human NK1R GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human NK1R GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 309-407 of Human NK1R

Source: Wheat Germ (in vitro)

Amino Acid Sequence: NDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TACR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NK1R GST (N-Term) Protein

  • NK1R
  • NK-1R
  • NK1Rneurokinin 1 receptor
  • NKIR
  • SPR
  • SPRsubstance-P receptor
  • TAC1R
  • TAC1Rtachykinin 1 receptor (substance P receptor, neurokinin 1 receptor)
  • tachykinin receptor 1 (substance P receptor; neurokinin-1 receptor)
  • tachykinin receptor 1NK-1 receptor
  • TACR1

Background

This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5'-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins and 7 hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, also referred to as neurokinin 1. This receptor is also involved in the mediation of phosphatidylinositol metabolism of substance P. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4375
Species: Hu, Mu, Rt
Applications: IHC
MAB4077
Species: Hu
Applications: IHC, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-15304
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-14421
Species: Hu
Applications: IHC, IHC-P
NB300-102
Species: Gp, Hu(-), Mu, Rt, Sh
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, WB (-)
210-TA
Species: Hu
Applications: BA
NB300-201
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
D6050
Species: Hu
Applications: ELISA
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-19788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NB300-201
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
664-LI/CF
Species: Hu
Applications: BA
NBP3-15868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
AF1126
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB

Publications for NK1R Partial Recombinant Protein (H00006869-Q02) (0)

There are no publications for NK1R Partial Recombinant Protein (H00006869-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NK1R Partial Recombinant Protein (H00006869-Q02) (0)

There are no reviews for NK1R Partial Recombinant Protein (H00006869-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NK1R Partial Recombinant Protein (H00006869-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NK1R Products

Bioinformatics Tool for NK1R Partial Recombinant Protein (H00006869-Q02)

Discover related pathways, diseases and genes to NK1R Partial Recombinant Protein (H00006869-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NK1R Partial Recombinant Protein (H00006869-Q02)

Discover more about diseases related to NK1R Partial Recombinant Protein (H00006869-Q02).
 

Pathways for NK1R Partial Recombinant Protein (H00006869-Q02)

View related products by pathway.

PTMs for NK1R Partial Recombinant Protein (H00006869-Q02)

Learn more about PTMs related to NK1R Partial Recombinant Protein (H00006869-Q02).
 

Research Areas for NK1R Partial Recombinant Protein (H00006869-Q02)

Find related products by research area.

Blogs on NK1R

There are no specific blogs for NK1R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NK1R GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TACR1