NISCH Antibody (2C8)

Images

 
Sandwich ELISA: NISCH Antibody (2C8) [H00011188-M02] - Detection limit for recombinant GST tagged NISCH is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2C8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NISCH Antibody (2C8) Summary

Immunogen
NISCH (AAH56900, 1246 a.a. ~ 1346 a.a) partial recombinant protein with GST tag.LTGSTPMQVVTCLTRDSYLTHCFLQHLMVVLSSLERTPSPEP VDKDFYSEFGNKTTGKMENYELIHSSRVKFTYPSEEEIGDLT FTVAQKMAEPEKAPAL
Specificity
NISCH - nischarin
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NISCH
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NISCH Antibody (2C8)

  • hIRAS
  • I-1 receptor candidate protein
  • I-1FLJ14425
  • I1R candidate protein
  • I1R
  • Imidazoline receptor 1
  • imidazoline receptor antisera selected
  • Imidazoline receptor antisera-selected protein
  • imidazoline receptor candidate
  • Imidazoline-1 receptor candidate protein
  • Imidazoline-1 receptor
  • IR1
  • IRASFLJ40413
  • KIAA0975FLJ90519
  • nischarin

Background

Mouse Nischarin (NISCH) has been shown to interact with the alpha-5 subunit of integrin and inhibit cell migration. Its human homologue (imidazoline receptor antisera-selected (IRAS)), contains an NH2-terminal extension and is a larger protein of 1504 amino acids consisting of an NH2-terminal PX domain, 5 putative leucine-rich repeats, a predicted coiled-coil domain, and a long COOH-terminal region. It has the ability to homo-oligomerize via its coiled-coil region. The PX domain of IRAS is essential for association with phosphatidylinositol 3-phosphate-enriched endosomal membranes. NISCH may serve as a functional imidazoline I1-receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24490
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB400-153
Species: Hu
Applications: WB, ICC/IF
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-19773
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76993
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P

Publications for NISCH Antibody (H00011188-M02) (0)

There are no publications for NISCH Antibody (H00011188-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NISCH Antibody (H00011188-M02) (0)

There are no reviews for NISCH Antibody (H00011188-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NISCH Antibody (H00011188-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NISCH Products

Bioinformatics Tool for NISCH Antibody (H00011188-M02)

Discover related pathways, diseases and genes to NISCH Antibody (H00011188-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NISCH Antibody (H00011188-M02)

Discover more about diseases related to NISCH Antibody (H00011188-M02).
 

Pathways for NISCH Antibody (H00011188-M02)

View related products by pathway.

PTMs for NISCH Antibody (H00011188-M02)

Learn more about PTMs related to NISCH Antibody (H00011188-M02).
 

Research Areas for NISCH Antibody (H00011188-M02)

Find related products by research area.

Blogs on NISCH

There are no specific blogs for NISCH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NISCH Antibody (2C8) and receive a gift card or discount.

Bioinformatics

Gene Symbol NISCH
Entrez
Uniprot