NIR2 Antibody - BSA Free

Western Blot: NIR2 Antibody [NBP3-35303] - Western blot analysis of various lysates using NIR2 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NIR2 Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human NIR2 (NP_004901.2).
  
  Sequence:
  EIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWARTAAQTGPLMCAY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 135 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for NIR2 Antibody - BSA Free

• DRES9NIR-2
• Drosophila retinal degeneration B homolog
• FLJ44997
• membrane-associated phosphatidylinositol transfer protein 1
• NIR2PITPNM
• phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2
• PITPnm 1
• Rd9
• RDGB
• RDGB1
• RDGBA
• RDGBA1
• retinal degeneration B alpha 1

Background

NIR2 belongs to a family of proteins that share homology with the Drosophila retinal degeneration B (rdgB) protein. Nir2, a human homolog of Drosophila melanogaster retinal degeneration B protein, is essential for cytokinesis. A specific Thr residue in the Nir2 PI-transfer domain provides a regulatory site for targeting to lipid droplets. This may affect intracellular lipid trafficking and distribution & explain the dominant effect of the RdgB-T59E mutant on retinal degeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITPNM1