NIR2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NIR2 Antibody [NBP2-56687] - Staining of human cell line HaCaT shows localization to cytosol & microtubule organizing center.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NIR2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRRGSMNNELLSPEFGPVRDPLADGVEGLGRGSPEPSALPPQRIPSDMASPEPEGSQNSLQAA
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PITPNM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  NIR2 Recombinant Protein Antigen (NBP2-56687PEP)

Reactivity Notes

Mouse 83%, Rat 83%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NIR2 Antibody - BSA Free

• DRES9NIR-2
• Drosophila retinal degeneration B homolog
• FLJ44997
• membrane-associated phosphatidylinositol transfer protein 1
• NIR2PITPNM
• phosphatidylinositol transfer protein, membrane-associated 1Pyk2 N-terminal domain-interacting receptor 2
• PITPnm 1
• Rd9
• RDGB
• RDGB1
• RDGBA
• RDGBA1
• retinal degeneration B alpha 1

Background

NIR2 belongs to a family of proteins that share homology with the Drosophila retinal degeneration B (rdgB) protein. Nir2, a human homolog of Drosophila melanogaster retinal degeneration B protein, is essential for cytokinesis. A specific Thr residue in the Nir2 PI-transfer domain provides a regulatory site for targeting to lipid droplets. This may affect intracellular lipid trafficking and distribution & explain the dominant effect of the RdgB-T59E mutant on retinal degeneration.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PITPNM1