NIPP1 Antibody (4B5)

Images

 
Western Blot: NIPP1 Antibody (4B5) [H00005511-M05] - Analysis of PPP1R8 expression in transfected 293T cell line by PPP1R8 monoclonal antibody (M05), clone 4B5. Lane 1: PPP1R8 transfected lysate (Predicted MW: 38.5 ...read more
ELISA: NIPP1 Antibody (4B5) [H00005511-M05] - Detection limit for recombinant GST tagged PPP1R8 is approximately 3ng/ml as a capture antibody.
Immunoprecipitation: NIPP1 Antibody (4B5) [H00005511-M05] - Analysis of PPP1R8 transfected lysate using anti-PPP1R8 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PPP1R8 monoclonal antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IP
Clone
4B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NIPP1 Antibody (4B5) Summary

Immunogen
PPP1R8 (NP_002704.1, 28 a.a. - 127 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI
Specificity
PPP1R8 - protein phosphatase 1, regulatory (inhibitor) subunit 8 (4B5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PPP1R8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunoprecipitation
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NIPP1 Antibody (4B5)

  • activator of RNA decay
  • ARD1
  • ard-1
  • ARD1nuclear inhibitor of protein phosphatase 1
  • NIPP1
  • NIPP1nuclear inhibitor of protein phosphatase-1
  • NIPP-1nuclear subunit of PP-1
  • PPP1R8
  • PRO2047
  • Protein phosphatase 1 regulatory inhibitor subunit 8
  • protein phosphatase 1 regulatory subunit 8
  • protein phosphatase 1, regulatory (inhibitor) subunit 8
  • RNase E

Background

This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82485
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24490
Species: Hu, Ca, Eq, Pm
Applications: WB, IHC-P
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP2-19461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-43679
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00005511-M05
Species: Hu
Applications: WB, ELISA, IP

Publications for NIPP1 Antibody (H00005511-M05) (0)

There are no publications for NIPP1 Antibody (H00005511-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIPP1 Antibody (H00005511-M05) (0)

There are no reviews for NIPP1 Antibody (H00005511-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIPP1 Antibody (H00005511-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIPP1 Products

Bioinformatics Tool for NIPP1 Antibody (H00005511-M05)

Discover related pathways, diseases and genes to NIPP1 Antibody (H00005511-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIPP1 Antibody (H00005511-M05)

Discover more about diseases related to NIPP1 Antibody (H00005511-M05).
 

Pathways for NIPP1 Antibody (H00005511-M05)

View related products by pathway.

PTMs for NIPP1 Antibody (H00005511-M05)

Learn more about PTMs related to NIPP1 Antibody (H00005511-M05).

Blogs on NIPP1

There are no specific blogs for NIPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIPP1 Antibody (4B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R8
Entrez
Uniprot