Recombinant Human NIFK Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NIFK Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-293 of Human MKI67IP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPTFLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ

Protein/Peptide Type
Recombinant Protein
Gene
MKI67IP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NIFK Protein

  • hNIFK
  • MKI67 (FHA domain) interacting nucleolar phosphoprotein
  • MKI67 FHA domain-interacting nucleolar phosphoprotein
  • NIFKNOPP34
  • Nopp34
  • Nucleolar phosphoprotein Nopp34
  • Nucleolar protein interacting with the FHA domain of pKI-67

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83252
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB500-170
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-13657
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NB600-1159
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88689
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00084365-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NIFK Recombinant Protein (H00084365-P01) (0)

There are no publications for NIFK Recombinant Protein (H00084365-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIFK Recombinant Protein (H00084365-P01) (0)

There are no reviews for NIFK Recombinant Protein (H00084365-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIFK Recombinant Protein (H00084365-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NIFK Products

Bioinformatics Tool for NIFK Recombinant Protein (H00084365-P01)

Discover related pathways, diseases and genes to NIFK Recombinant Protein (H00084365-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIFK Recombinant Protein (H00084365-P01)

Discover more about diseases related to NIFK Recombinant Protein (H00084365-P01).
 

Pathways for NIFK Recombinant Protein (H00084365-P01)

View related products by pathway.

PTMs for NIFK Recombinant Protein (H00084365-P01)

Learn more about PTMs related to NIFK Recombinant Protein (H00084365-P01).
 

Research Areas for NIFK Recombinant Protein (H00084365-P01)

Find related products by research area.

Blogs on NIFK

There are no specific blogs for NIFK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NIFK Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MKI67IP