NIF3L1 Antibody

Images

 
Western Blot: NIF3L1 Antibody [NBP1-89115] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: NIF3L1 Antibody [NBP1-89115] - Staining of human tonsil shows strong cytoplasmic and nuclear positivity.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NIF3L1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NIF3L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NIF3L1 Protein (NBP1-89115PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NIF3L1 Antibody

  • ALS2CR1
  • candidate 1
  • MDS015
  • NIF3 NGG1 interacting factor 3-like 1 (S. pombe)
  • NIF3-like protein 1
  • S.pombe homolog)-like 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15369
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-90183
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90189
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-77020
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56123
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
AF1759
Species: Hu, Mu
Applications: WB, Simple Western, IP, ChIP, ICC
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89115
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for NIF3L1 Antibody (NBP1-89115) (0)

There are no publications for NIF3L1 Antibody (NBP1-89115).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NIF3L1 Antibody (NBP1-89115) (0)

There are no reviews for NIF3L1 Antibody (NBP1-89115). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NIF3L1 Antibody (NBP1-89115) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NIF3L1 Products

Bioinformatics Tool for NIF3L1 Antibody (NBP1-89115)

Discover related pathways, diseases and genes to NIF3L1 Antibody (NBP1-89115). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NIF3L1 Antibody (NBP1-89115)

Discover more about diseases related to NIF3L1 Antibody (NBP1-89115).
 

Pathways for NIF3L1 Antibody (NBP1-89115)

View related products by pathway.

Blogs on NIF3L1

There are no specific blogs for NIF3L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NIF3L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NIF3L1