Nicotinic Acetylcholine Receptor beta 2 Antibody (1C7)

Images

 
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody (1C7) [H00001141-M01] - CHRNB2 monoclonal antibody (M01), clone 1C7. Analysis of CHRNB2 expression in rat testis.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
1C7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Nicotinic Acetylcholine Receptor beta 2 Antibody (1C7) Summary

Immunogen
CHRNB2 (NP_000739.1, 26 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CHRNB2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Nicotinic Acetylcholine Receptor beta 2 Antibody (1C7)

  • cholinergic receptor, nicotinic, beta 2 (neuronal)
  • cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal)
  • EFNL3
  • nAChRB2
  • neuronal acetylcholine receptor subunit beta-2
  • neuronal nicotinic acetylcholine receptor beta 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69122
Species: Hu
Applications: WB
NBP1-80090
Species: Hu
Applications: WB
NBP1-79948
Species: Hu, Rt
Applications: WB
H00001142-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87534
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-60788
Species: Mu, Rt
Applications: WB, ICC/IF
NBP2-58876
Species: Hu
Applications: ICC/IF
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-04663
Species: Hu
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP1-88645
Species: Hu
Applications: IHC, IHC-P
NBP1-74102
Species: Mu, ChHa
Applications: WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBL1-07321
Species: Hu

Publications for Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01) (0)

There are no publications for Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01) (0)

There are no reviews for Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine Receptor beta 2 Products

Bioinformatics Tool for Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01)

Discover more about diseases related to Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01).
 

Pathways for Nicotinic Acetylcholine Receptor beta 2 Antibody (H00001141-M01)

View related products by pathway.

Blogs on Nicotinic Acetylcholine Receptor beta 2

There are no specific blogs for Nicotinic Acetylcholine Receptor beta 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine Receptor beta 2 Antibody (1C7) and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNB2
Uniprot