Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody


Western Blot: CHRNA9 Antibody [NBP1-79949] - Jurkat cell lysate, concentration 0.0625ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody Summary

Synthetic peptide directed towards the N terminal of human CHRNA9The immunogen for this antibody is CHRNA9. Peptide sequence MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVE.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against CHRNA9 and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody

  • cholinergic receptor, nicotinic, alpha 9
  • cholinergic receptor, nicotinic, alpha polypeptide 9
  • CHRNA9
  • HSA243342
  • MGC142109
  • MGC142135
  • NACHR alpha 9
  • NACHR alpha-9
  • NACHRA9acetylcholine receptor, neuronal nicotinic, alpha-9 subunit
  • neuronal acetylcholine receptor protein, alpha-9 subunit
  • neuronal acetylcholine receptor subunit alpha-9
  • Nicotinic Acetylcholine R alpha 9
  • Nicotinic Acetylcholine Ra 9
  • nicotinic acetylcholine receptor subunit alpha 9
  • Nicotinic acetylcholine receptor subunit alpha-9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Po, Bv, Ca, Ch, Eq, Mk
Applications: ELISA, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
Species: Hu
Applications: ICC/IF
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu
Applications: WB

Publications for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949) (0)

There are no publications for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Nicotinic Acetylcholine R alpha 9/CHRNA9 Products

Bioinformatics Tool for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949)

Discover related pathways, diseases and genes to Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949)

Discover more about diseases related to Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949).

Pathways for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949)

View related products by pathway.

PTMs for Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949)

Learn more about PTMs related to Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody (NBP1-79949).

Blogs on Nicotinic Acetylcholine R alpha 9/CHRNA9

There are no specific blogs for Nicotinic Acetylcholine R alpha 9/CHRNA9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 9/CHRNA9 Antibody and receive a gift card or discount.


Gene Symbol CHRNA9