Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody - BSA Free Summary
Description
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the N terminal of human CHRNA7. Peptide sequence QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA7
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
56 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Reviewed Applications
Read 1 Review rated 4 using NBP1-79948 in the following application:
The nicotinic acetylcholine receptors (nAChRs) are members of a superfamily of ligand-gated ion channels that mediatefast signal transmission at synapses. The nAChRs are thought to be hetero-pentamers composed of homologous subunits.The proposed structure for each subunit is a conserved N-terminal extracellular domain followed by three conservedtransmembrane domains, a variable cytoplasmic loop, a fourth conserved transmembrane domain, and a short C-terminalextracellular region. The protein encoded by this gene forms a homo-oligomeric channel, displays marked permeabilityto calcium ions and is a major component of brain nicotinic receptors that are blocked by, and highly sensitive to,alpha-bungarotoxin. Once this receptor binds acetylcholine, it undergoes an extensive change in conformation thataffects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. This gene islocated in a region identified as a major susceptibility locus for juvenile myoclonic epilepsy and a chromosomallocation involved in the genetic transmission of schizophrenia. An evolutionarily recent partial duplication event inthis region results in a hybrid containing sequence from this gene and a novel FAM7A gene. (provided by RefSeq)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Tissue Mouse brain tissue was perfused with 4% Paraformaldehyde in phosphate buffered saline (1x PBS) Brains were immersed in 30% sucrose in 1x PBS and sectioned at 40um on a microtome Slices were stored in cryoprotectant solution at -20C until used for immunohistochemistry
Immunohistochemistry Free floating sections were blocked with 5% normal goat serum (NGS) in 0.3% triton in 1x PBS The primary antibody, rb anti CHRNA7 (NBP1-79948), was used at 1:500 and incubated for two hours at room temperature followed by 12 hours at 4C. As a negative control, slices were incubated with blocking buffer and no primary antibody. The secondary antibody, Goat anti rabbit 633 (Alexa fluor), was used at 1:2000 and incubated with the slices for 90 minutes. Slices were mounted on glass slides with mounting media containing DAPI.
Results CHRNA7 (white) with DAPI (blue) in the CA1 region of the hippocampus. My conclusion is that the CHRNA7 antibody does work in IHC.
Images were taken using a Nikon confocal microscope and a 60x objective with 1.5 N.A.. The images are 1024 x 1024 pixels. The laser settings were exactly the same for both the CHRNA7 image and the no primary control. For the purpose of comparison, no image adjustments were made - these are jpegs from the raw .nd2 file z stack (1um steps).
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Nicotinic Acetylcholine R alpha 7/CHRNA7 Antibody (NBP1-79948). (Showing 1 - 2 of 2 FAQs).
I am doing research on Neuroscience and I would like to use some antibodies, especially in Western Blots, but I could do other assays: - alpha7 nicotinic cholinergic receptor; - parvalbumin; - calbindin D28K; The preferred reactivity is anti-human and anti-mouse. Do you have these antibodies? Are they in stock? And what about the prizes: How much are they? How much are the shipping costs? Could you make me any offer?
We currently have three alpha7 nicotinic cholingergic receptor antibodies available for purchase. Please see this list for our Parvalbumin antibodies. None are currently validated in mouse. I would like to introduce you to our Innovators Reward Program. We have an excelent calbinin D28K antibody that has been validated for use in human and mouse and WB. The pricing and availability of our products depends on your country.
I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.