Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [DyLight 488]

• Reactivity: Mu
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: DyLight 488

Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [DyLight 488] Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 29-242 of human Nicotinic Acetylcholine R alpha 4/CHRNA4 (P43681).
  
  Sequence:
  HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CHRNA4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

• Storage: Store at 4C in the dark.
• Buffer: 50mM Sodium Borate
• Preservative: 0.05% Sodium Azide
• Purity: Affinity purified

Notes

DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

Alternate Names for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [DyLight 488]

• nAchRa4
• BFNC
• cholinergic receptor, nicotinic, alpha 4
• cholinergic receptor, nicotinic, alpha polypeptide 4
• CHRNA4
• EBN
• EBN1
• ENFL1
• FLJ95812
• nAChR alpha 4
• NACHR
• NACHRA4
• NACRA4
• neuronal acetylcholine receptor subunit alpha-4
• neuronal nicotinic acetylcholine receptor alpha-4 subunit
• Nicotinic Acetylcholine R alpha 4
• Nicotinic Acetylcholine Ra4

Background

Nicotinic Acetylcholine Receptor alpha 4 encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (NBP3-35674G). (Showing 1 - 1 of 1 FAQ).

1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
   • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Bioinformatics

• Gene Symbol: CHRNA4