Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [Alexa Fluor® 750]

Images

 
There are currently no images for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (NBP3-35674AF750).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Alexa Fluor 750

Order Details

Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [Alexa Fluor® 750] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 29-242 of human Nicotinic Acetylcholine R alpha 4/CHRNA4 (P43681).

Sequence:
HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVNMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CHRNA4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [Alexa Fluor® 750]

  • nAchRa4
  • BFNC
  • cholinergic receptor, nicotinic, alpha 4
  • cholinergic receptor, nicotinic, alpha polypeptide 4
  • CHRNA4
  • EBN
  • EBN1
  • ENFL1
  • FLJ95812
  • nAChR alpha 4
  • NACHR
  • NACHRA4
  • NACRA4
  • neuronal acetylcholine receptor subunit alpha-4
  • neuronal nicotinic acetylcholine receptor alpha-4 subunit
  • Nicotinic Acetylcholine R alpha 4
  • Nicotinic Acetylcholine Ra4

Background

Nicotinic Acetylcholine Receptor alpha 4 encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1519
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-FrFl, PEP-ELISA, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-28467
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-30052
Species: Ch, Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-38820
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-74102
Species: Ha, Mu
Applications: WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
H00001134-Q01
Species: Hu
Applications: ELISA, Flow, AP, PA, PAGE, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP3-35674AF750
Species: Mu
Applications: WB, ELISA

Publications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (NBP3-35674AF750) (0)

There are no publications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (NBP3-35674AF750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (NBP3-35674AF750) (0)

There are no reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (NBP3-35674AF750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (NBP3-35674AF750). (Showing 1 - 1 of 1 FAQ).

  1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
    • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Secondary Antibodies

 

Isotype Controls

Additional Nicotinic Acetylcholine R alpha 4/CHRNA4 Products

Research Areas for Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody (NBP3-35674AF750)

Find related products by research area.

Blogs on Nicotinic Acetylcholine R alpha 4/CHRNA4

There are no specific blogs for Nicotinic Acetylcholine R alpha 4/CHRNA4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Nicotinic Acetylcholine R alpha 4/CHRNA4 Antibody [Alexa Fluor® 750] and receive a gift card or discount.

Bioinformatics

Gene Symbol CHRNA4