Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein

SDS-Page: Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 Protein [H00001134-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, Flow, MA, PAGE, AP

Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 146-231 of Human Nicotinic Acetylcholine R alpha 1/CHRNA1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: CHRNA1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Flow Cytometry
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
• Application Notes: Use in FLOW cytometry and blocking/ neutralizing reported in scientific literature ( PMID 25050620)
• Theoretical MW: 35.2 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nicotinic Acetylcholine R alpha 1/CHRNA1 GST (N-Term) Protein

• acetylcholine receptor subunit alpha
• ACHRA
• ACHRD
• CHNRA
• cholinergic receptor, nicotinic, alpha 1 (muscle)
• CHRNA
• CHRNA1
• CMS2A
• FCCMS
• nAChR alpha 1
• nAchRa1
• Nicotinic Acetylcholine R alpha 1
• Nicotinic Acetylcholine Ra1
• nicotinic acetylcholine receptor alpha subunit
• nicotinic cholinergic receptor alpha 1
• nicotinic, alpha polypeptide 1 (muscle)
• SCCMS

Background

The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Nicotinic Acetylcholine R alpha 1/CHRNA1 Partial Recombinant Protein (H00001134-Q01)(1)

Publication using H00001134-Q01

• Kusner LL, Ciesielski MJ, Marx A et al. Survivin as a potential mediator to support autoreactive cell survival in myasthenia gravis: a human and animal model study. PLoS ONE 2014-07-23 [PMID: 25050620] (B/N, FLOW, Human)
  
  Details:
  Using the DyLight 650 conjugated version of NB500-238, catalog number NB500-238C.

FAQs for Nicotinic Acetylcholine R alpha 1/CHRNA1 Partial Recombinant Protein (H00001134-Q01). (Showing 1 - 1 of 1 FAQ).

1. I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.
   • A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

Bioinformatics

• Gene Symbol: CHRNA1