NHP2 Recombinant Protein Antigen

Images

 
There are currently no images for NHP2 Protein (NBP2-13656PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NHP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NHP2.

Source: E. coli

Amino Acid Sequence: LAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGSKRPTCVIMVKPHEEYQEAYDECLEEVQSLP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NHP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13656.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NHP2 Recombinant Protein Antigen

  • FLJ20479
  • H/ACA ribonucleoprotein complex subunit 2
  • NHP2 ribonucleoprotein homolog (yeast)
  • NHP2-like protein
  • NHP2P
  • NOLA2member 2 (H/ACA small nucleolar RNPs)
  • Nucleolar protein family A member 2
  • snoRNP protein NHP2

Background

NHP2 is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also include the DKC1, NOLA1 and NOLA3 proteins. These four H/ACA snoRNP proteins localize to the dense fibrillar components of nucleoli and to coiled (Cajal) bodies in the nucleus. Both 18S rRNA production and rRNA pseudouridylation are impaired if any one of the four proteins is depleted. The four H/ACA snoRNP proteins are also components of the telomerase complex. This gene encodes a protein related to Saccharomyces cerevisiae Nhp2p. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32441
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85156
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-31742
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western
NBP3-12461
Species: Hu, Rt
Applications: ELISA, IP, WB
NBP2-55709
Species: Hu
Applications: ICC/IF, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP1-32732
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC,  IHC-P, IP, WB
NBP1-89306
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP1-81680
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00065057-M02
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NB100-68252
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KO, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP3-38210
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-97768
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-13656PEP
Species: Hu
Applications: AC

Publications for NHP2 Protein (NBP2-13656PEP) (0)

There are no publications for NHP2 Protein (NBP2-13656PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHP2 Protein (NBP2-13656PEP) (0)

There are no reviews for NHP2 Protein (NBP2-13656PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NHP2 Protein (NBP2-13656PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NHP2 Products

Research Areas for NHP2 Protein (NBP2-13656PEP)

Find related products by research area.

Blogs on NHP2

There are no specific blogs for NHP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NHP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NHP2