NHLH1 Antibody

Images

 
Western Blot: NHLH1 Antibody [H00004807-B01P] - Analysis of NHLH1 expression in transfected 293T cell line by NHLH1 polyclonal antibody. Lane 1: NHLH1 transfected lysate(14.63 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NHLH1 Antibody Summary

Immunogen
NHLH1 (NP_005589.1, 1 a.a. - 133 a.a.) full-length human protein. MMLNSDTMELDLPPTHSETESGFSDCGGGAGPDGAGPGGPGGGQARGPEPGEPGRKDLQHLSREERRRRRRATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV
Specificity
NHLH1 - nescient helix loop helix 1,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
NHLH1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NHLH1 Antibody

  • BHLHA35
  • bHLHa35HEN-1
  • helix-loop-helix protein 1
  • HEN1NSCL-1
  • nescient helix loop helix 1Class A basic helix-loop-helix protein 35
  • NSCL
  • NSCL1

Background

The helix-loop-helix (HLH) proteins are a family of putative transcription factors, some of which have been shown to play an important role in growth and development of a wide variety of tissues and species. Four members of this family have been clearly implicated in tumorigenesis via their involvement in chromosomal translocations in lymphoid tumors: MYC (MIM 190080), LYL1 (MIM 151440), E2A (MIM 147141), and SCL (MIM 187040).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-51911
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF6367
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
AF6548
Species: Hu, Mu
Applications: IHC
NBP2-01488
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2746
Species: Hu, Mu
Applications: WB, ICC
NBP2-45478
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC
NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-06520
Species: Hu, Mu
Applications: WB, IP
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
MAB7650
Species: Mu
Applications: WB, IHC
NBP1-77847
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, IHC, IHC-P, IP
NBP2-13958
Species: Hu
Applications: IHC, IHC-P
NBP1-87257
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
H00004807-B01P
Species: Hu
Applications: WB

Publications for NHLH1 Antibody (H00004807-B01P) (0)

There are no publications for NHLH1 Antibody (H00004807-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHLH1 Antibody (H00004807-B01P) (0)

There are no reviews for NHLH1 Antibody (H00004807-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHLH1 Antibody (H00004807-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHLH1 Products

Bioinformatics Tool for NHLH1 Antibody (H00004807-B01P)

Discover related pathways, diseases and genes to NHLH1 Antibody (H00004807-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NHLH1 Antibody (H00004807-B01P)

Discover more about diseases related to NHLH1 Antibody (H00004807-B01P).
 

Pathways for NHLH1 Antibody (H00004807-B01P)

View related products by pathway.

PTMs for NHLH1 Antibody (H00004807-B01P)

Learn more about PTMs related to NHLH1 Antibody (H00004807-B01P).

Blogs on NHLH1

There are no specific blogs for NHLH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHLH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NHLH1
Entrez
Uniprot