Novus Biologicals products are now on bio-techne.com

NHE6/SLC9A6 Antibody (2D5)

Images

 
Western Blot: NHE6/SLC9A6 Antibody (2D5) [H00010479-M02] - Analysis of SLC9A6 expression in transfected 293T cell line by SLC9A6 monoclonal antibody (M02), clone 2D5. Lane 1: SLC9A6 transfected lysate(77.9 KDa). Lane ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NHE6/SLC9A6 Antibody (2D5) Summary

Immunogen
SLC9A6 (NP_006350, 602 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YGDSTVNTEPATSSAPRRFMGNSSEDALDRELAFGDHELVIRGTRLVLPMDDSEPPLNLLDNTRHGPA
Specificity
SLC9A6 - solute carrier family 9 (sodium/hydrogen exchanger), member 6 (2D5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC9A6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NHE6/SLC9A6 Antibody (2D5)

  • MRSA
  • NHE6
  • NHE6isoform 6
  • SLC9A6
  • solute carrier family 9 (sodium/hydrogen exchanger), member 6
  • Solute carrier family 9 member 6

Background

The SLC9A6 gene encodes a monovalent sodium-selective sodium/hydrogen exchanger (NHE) that is found in the membranes of intracellular organelles such as mitochondria and endosomes. NHEs participate in a wide array of essential cellular processes, including control of intracellular pH, maintenance of cellular volume, and reabsorption of sodium across renal, intestinal, and other epithelia.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
DY393
Species: Hu
Applications: ELISA
AF4538
Species: Hu, Mu, Rt
Applications: WB
AF5520
Species: Hu, Mu
Applications: WB
AF6270
Species: Hu
Applications: ICC
NBP2-85831
Species: Hu
Applications: IHC, IHC-P, WB
DY1707
Species: Hu
Applications: ELISA
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB600-1151
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00004810-M05
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-01446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-86928
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-92172
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for NHE6/SLC9A6 Antibody (H00010479-M02) (0)

There are no publications for NHE6/SLC9A6 Antibody (H00010479-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NHE6/SLC9A6 Antibody (H00010479-M02) (0)

There are no reviews for NHE6/SLC9A6 Antibody (H00010479-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NHE6/SLC9A6 Antibody (H00010479-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NHE6/SLC9A6 Products

Research Areas for NHE6/SLC9A6 Antibody (H00010479-M02)

Find related products by research area.

Blogs on NHE6/SLC9A6

There are no specific blogs for NHE6/SLC9A6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NHE6/SLC9A6 Antibody (2D5) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC9A6
Entrez
Uniprot