Recombinant Human NGFI-B alpha/Nur77/NR4A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NGFI-B alpha/Nur77/NR4A1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 598 of Human NR4A1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MPCIQAQYGTPAPSPGPRDHLASDPLTPEFIKPTMDLASPEAAPAAPTALPSFSTFMDGYTGEFDTFLYQLPGTVQPCSSASSSASSTSSSSATSPASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASGPPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGEGESYSMPTAFPGLAPTSPHLEGSGILDTPVTSTKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPADQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHSLLVDVPAFACLSALVLITDRHGLQEPRRVEELQNRIASCLKEHVAAVAGEPQPASCLSRLLGKLPELRTLCTRGLQRIFYLKLEDLVPPPPIIDKIFMDTLPF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NR4A1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NGFI-B alpha/Nur77/NR4A1 Protein

  • Early response protein NAK1
  • GFRP1ST-59
  • growth factor-inducible nuclear protein N10
  • HMR
  • HMRNP10
  • hormone receptor
  • MGC9485
  • N10
  • NAK1
  • NAK-1
  • NGFIB alpha
  • NGFI-B alpha
  • NGFIB
  • NR4A1
  • Nuclear hormone receptor NUR/77
  • nuclear receptor subfamily 4 group A member 1
  • nuclear receptor subfamily 4, group A, member 1
  • Nur77
  • Orphan nuclear receptor HMR
  • Orphan nuclear receptor TR3
  • steroid receptor TR3
  • Testicular receptor 3
  • TR3 orphan receptor
  • TR3

Background

This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. Expression is induced by phytohemagglutinin in human lymphocytes and by serum stimulation of arrested fibroblasts. The encoded protein acts as a nuclear transcription factor. Translocation of the protein from the nucleus to mitochondria induces apoptosis. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2156
Species: Hu, Mu
Applications: WB, IHC
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56530
Species: Hu
Applications: WB
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01) (0)

There are no publications for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01) (0)

There are no reviews for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NGFI-B alpha/Nur77/NR4A1 Products

Bioinformatics Tool for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01)

Discover related pathways, diseases and genes to NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01)

Discover more about diseases related to NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01).
 

Pathways for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01)

View related products by pathway.

PTMs for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01)

Learn more about PTMs related to NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01).
 

Research Areas for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein (H00003164-P01)

Find related products by research area.

Blogs on NGFI-B alpha/Nur77/NR4A1

There are no specific blogs for NGFI-B alpha/Nur77/NR4A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NGFI-B alpha/Nur77/NR4A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NR4A1
Entrez