NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen

Images

 
There are currently no images for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen (NBP2-68896PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NGFI-B alpha/Nur77/NR4A1.

Source: E. coli

Amino Acid Sequence: PANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NR4A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68896.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen

  • Early response protein NAK1
  • GFRP1ST-59
  • growth factor-inducible nuclear protein N10
  • HMR
  • HMRNP10
  • hormone receptor
  • MGC9485
  • N10
  • NAK1
  • NAK-1
  • NGFIB alpha
  • NGFI-B alpha
  • NGFIB
  • NR4A1
  • Nuclear hormone receptor NUR/77
  • nuclear receptor subfamily 4 group A member 1
  • nuclear receptor subfamily 4, group A, member 1
  • Nur77
  • Orphan nuclear receptor HMR
  • Orphan nuclear receptor TR3
  • steroid receptor TR3
  • Testicular receptor 3
  • TR3 orphan receptor
  • TR3

Background

Nak1 is a member of the steroid/thyroid hormone receptor superfamily. The gene for Nak-1 is induced rapidly by androgens/growth factors and may have functions related to cell proliferation, differentiation and apoptosis (1). Liu et al (2) have demonstrated that mouse nur77 is necessary for induced apoptosis in T-cell hybridomas and can also be induced during early mitogenesis. Nak1 is a phosphoprotein and its size ranges from 67 kD to 88 kD, depending on post-translational modifications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2156
Species: Hu, Mu
Applications: ICC, IHC, WB
PP-H7833-00
Species: Hu
Applications: IP, WB
AF2818
Species: Hu
Applications: ICC, WB
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF4888
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
NBP2-14998
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB100-1923
Species: Ce
Applications: IHC,  IHC-P, IP, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF2214
Species: Hu
Applications: ICC, IHC, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP2-68896PEP
Species: Hu
Applications: AC

Publications for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen (NBP2-68896PEP) (0)

There are no publications for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen (NBP2-68896PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen (NBP2-68896PEP) (0)

There are no reviews for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen (NBP2-68896PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen (NBP2-68896PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NGFI-B alpha/Nur77/NR4A1 Products

Research Areas for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen (NBP2-68896PEP)

Find related products by research area.

Blogs on NGFI-B alpha/Nur77/NR4A1.

Tired T cells: Hypoxia Drives T cell Exhaustion in the Tumor Microenvironment
By Hunter MartinezThe paradigm shifting view of the immune system being leveraged to target cancer has led to numerous therapeutic breakthroughs. One major cell group responsible for this revelation is a T cell. ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NR4A1