NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NGFI-B alpha/Nur77/NR4A1.

  Source: E. coli

  Amino Acid Sequence: PASASFKFEDFQVYGCYPGPLSGPVDEALSSSGSDYYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPSQTYEGLRAWTEQLPKASG

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NR4A1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58600.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NGFI-B alpha/Nur77/NR4A1 Recombinant Protein Antigen

• Early response protein NAK1
• GFRP1ST-59
• growth factor-inducible nuclear protein N10
• HMR
• HMRNP10
• hormone receptor
• MGC9485
• N10
• NAK1
• NAK-1
• NGFIB alpha
• NGFI-B alpha
• NGFIB
• NR4A1
• Nuclear hormone receptor NUR/77
• nuclear receptor subfamily 4 group A member 1
• nuclear receptor subfamily 4, group A, member 1
• Nur77
• Orphan nuclear receptor HMR
• Orphan nuclear receptor TR3
• steroid receptor TR3
• Testicular receptor 3
• TR3 orphan receptor
• TR3

Background

Nak1 is a member of the steroid/thyroid hormone receptor superfamily. The gene for Nak-1 is induced rapidly by androgens/growth factors and may have functions related to cell proliferation, differentiation and apoptosis (1). Liu et al (2) have demonstrated that mouse nur77 is necessary for induced apoptosis in T-cell hybridomas and can also be induced during early mitogenesis. Nak1 is a phosphoprotein and its size ranges from 67 kD to 88 kD, depending on post-translational modifications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: NR4A1