NFX1 Antibody (1D12)

Images

 
Western Blot: NFX1 Antibody (1D12) [H00004799-M01] - NFX1 monoclonal antibody (M01), clone 1D12 Analysis of NFX1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: NFX1 Antibody (1D12) [H00004799-M01] - Analysis of monoclonal antibody to NFX1 on HeLa cell. Antibody concentration 30 ug/ml.
Sandwich ELISA: NFX1 Antibody (1D12) [H00004799-M01] - Detection limit for recombinant GST tagged NFX1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1D12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NFX1 Antibody (1D12) Summary

Immunogen
NFX1 (NP_002495 981 a.a. - 1080 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KFSDSLKEDARKDLKFVSDVEKEMETLVEAVNKGKNSKKSHSFPPMNRDHRRIIHDLAQVYGLESVSYDSEPKRNVVVTAIRGKSVCPPTTLTGVLEREM
Localization
Nuclear
Specificity
NFX1 - nuclear transcription factor, X-box binding 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NFX1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NFX1 Antibody (1D12)

  • DKFZp779G2416
  • EC 6.3.2.-
  • MGC20369
  • NFX2transcriptional repressor NF-X1
  • Nuclear transcription factor, X box-binding protein 1
  • nuclear transcription factor, X-box binding 1

Background

MHC class II gene expression is controlled primarily at the transcriptional level by transcription factors that bind to the X and Y boxes, two highly conserved elements in the proximal promoter of MHC class II genes. The protein encoded by this gene is a transcriptional repressor capable of binding to the conserved X box motif of HLA-DRA and other MHC class II genes in vitro. The protein may play a role in regulating the duration of an inflammatory response by limiting the period in which class II MHC molecules are induced by IFN-gamma. Three alternative splice variants, each of which encodes a different isoform, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49341
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-240
Species: Hu, Mu
Applications: WB, IP
NB100-317
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00004068-M01
Species: Hu
Applications: WB, ELISA
NBP1-30321
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006428-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-58069
Species: Hu
Applications: ICC/IF
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB120-3515
Species: Hu, Rt, Po, Bv, Ca, Fi, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, ICC
H00004799-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for NFX1 Antibody (H00004799-M01) (0)

There are no publications for NFX1 Antibody (H00004799-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFX1 Antibody (H00004799-M01) (0)

There are no reviews for NFX1 Antibody (H00004799-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for NFX1 Antibody (H00004799-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NFX1 Products

Bioinformatics Tool for NFX1 Antibody (H00004799-M01)

Discover related pathways, diseases and genes to NFX1 Antibody (H00004799-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NFX1 Antibody (H00004799-M01)

Discover more about diseases related to NFX1 Antibody (H00004799-M01).
 

Pathways for NFX1 Antibody (H00004799-M01)

View related products by pathway.

PTMs for NFX1 Antibody (H00004799-M01)

Learn more about PTMs related to NFX1 Antibody (H00004799-M01).
 

Research Areas for NFX1 Antibody (H00004799-M01)

Find related products by research area.

Blogs on NFX1

There are no specific blogs for NFX1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NFX1 Antibody (1D12) and receive a gift card or discount.

Bioinformatics

Gene Symbol NFX1
Entrez
OMIM
Uniprot