We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NFRKB Recombinant Protein Antigen

Images

 
There are currently no images for NFRKB Protein (NBP1-85096PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NFRKB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFRKB.

Source: E. coli

Amino Acid Sequence: SLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPVPRVRTDYVVRPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NFRKB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85096.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NFRKB Recombinant Protein Antigen

  • DKFZp547B2013
  • DNA-binding protein R kappa-B
  • INO80 complex subunit G
  • INO80GDNA-binding protein R kappa B
  • nuclear factor related to kappaB binding protein
  • nuclear factor related to kappa-B-binding protein

Background

NFRKB (nuclear factor related to kappa-B-binding protein) was first identified as a factor that could bind a variant NF-kappa B site in the interleukin-2 receptor alpha (IL-2R alpha) gene. NFRKB appears to be a transcription factor central to immune cell development. Evidence of this comes from the identification of NFRKB as an amplified gene in several cases of acute myeloid leukemia. Additionally, in another clinical case, a partial deletion of the chromosomal region that includes NFRKB is shown to be associated with combined cellular immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78759
Species: Hu
Applications: IP, WB
AF7284
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87925
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-16500
Species: Hu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-93687
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-38097
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1213
Species: Mu
Applications: Block, ICC, IHC, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NB100-56508
Species: Av, Hu, Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, IHC,  IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-43278
Species: Hu
Applications: Flow, IHC,  IHC-P
NBP1-85281
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB110-40709
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-72055
Species: Bv, Ca, Hu, Mu, Po, Rt
Applications: Flow, ICC/IF, PEP-ELISA
H00009223-M03
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
AF2018
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
AF2699
Species: Mu
Applications: Simple Western, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
NBP1-85096PEP
Species: Hu
Applications: AC

Publications for NFRKB Protein (NBP1-85096PEP) (0)

There are no publications for NFRKB Protein (NBP1-85096PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFRKB Protein (NBP1-85096PEP) (0)

There are no reviews for NFRKB Protein (NBP1-85096PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NFRKB Protein (NBP1-85096PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFRKB Products

Blogs on NFRKB

There are no specific blogs for NFRKB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NFRKB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NFRKB