NFRKB Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

NFRKB Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NFRKB.
  
  

  Source: E. coli

  Amino Acid Sequence: SLPMLEERVLDWQSSPASSLNSWFSAAPNWAELVLPALQYLAGESRAVPSSFSPFVEFKEKTQQWKLLGQSQDNEKELAALFQLWLETKDQAFCKQENEDSSDATTPVPRVRTDYVVRPS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NFRKB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85096.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NFRKB Recombinant Protein Antigen

• DKFZp547B2013
• DNA-binding protein R kappa-B
• INO80 complex subunit G
• INO80GDNA-binding protein R kappa B
• nuclear factor related to kappaB binding protein
• nuclear factor related to kappa-B-binding protein

Background

NFRKB (nuclear factor related to kappa-B-binding protein) was first identified as a factor that could bind a variant NF-kappa B site in the interleukin-2 receptor alpha (IL-2R alpha) gene. NFRKB appears to be a transcription factor central to immune cell development. Evidence of this comes from the identification of NFRKB as an amplified gene in several cases of acute myeloid leukemia. Additionally, in another clinical case, a partial deletion of the chromosomal region that includes NFRKB is shown to be associated with combined cellular immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: NFRKB