NFKBIL2 Recombinant Protein Antigen

Images

 
There are currently no images for NFKBIL2 Protein (NBP1-87764PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NFKBIL2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TONSL.

Source: E. coli

Amino Acid Sequence: WNRRNDMGETLLHRACIEGQLRRVQDLVRQGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGGQGCEGITPLHDALNCGHFEVAELLLERGASVTLRTRK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TONSL
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87764. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NFKBIL2 Recombinant Protein Antigen

  • IkappaBR
  • I-kappa-B-related protein
  • IKBRFLJ40087
  • Inhibitor of kappa B-related protein
  • NF-kappa-B inhibitor-like protein 2
  • NFKBIL2tonsoku-like protein
  • Nuclear factor of kappa light polypeptide gene enhancer in B-cellsinhibitor-like 2ikappaBR
  • tonsoku-like, DNA repair protein

Background

Sharing some sequence similarities with IKBKB, NF-kappa-B inhibitor-like protein 2 (NFKBIL2) belongs to the Tonsoku family. Also known as TONSL, the protein encoded by this gene may bind NF-kappa-B complex and trap them in the cytoplasm, preventing them from entering the nucleus and interacting with the DNA. Additionally, NFKBIL2 is a component of the MMS22L-TONSL complex. Used during DNA replication, this complex is essential for promoting homologous recombination repair of replication fork double strand breaks. NFKBIL2 is known to interact with MMS22L, MCM4, SSRP1, GSK3B and MCM2. Diseases associated with this gene include t-cell leukemia, psoriasis, breast cancer, atherosclerosis, leukemia and immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NBP2-57743
Species: Hu
Applications: ICC/IF
AF632
Species: Hu
Applications: AgAct, Simple Western, WB
NBP2-01345
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-88650
Species: Hu
Applications: IHC,  IHC-P, KD, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NBP2-75465
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89835
Species: Hu, Mu
Applications: IHC,  IHC-P
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-20123
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
AF2699
Species: Mu
Applications: Simple Western, WB
NBP2-02199
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-87964
Species: Hu
Applications: IHC,  IHC-P
NBP1-23017
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, KO, Simple Western, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87764PEP
Species: Hu
Applications: AC

Publications for NFKBIL2 Protein (NBP1-87764PEP) (0)

There are no publications for NFKBIL2 Protein (NBP1-87764PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NFKBIL2 Protein (NBP1-87764PEP) (0)

There are no reviews for NFKBIL2 Protein (NBP1-87764PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NFKBIL2 Protein (NBP1-87764PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NFKBIL2 Products

Array NBP1-87764PEP

Blogs on NFKBIL2

There are no specific blogs for NFKBIL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NFKBIL2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TONSL