Recombinant Human Neurotrimin/HNT Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Neurotrimin/HNT Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 29-138 of Human HNT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWCLDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKI

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
NTM

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Neurotrimin/HNT Protein

  • HNT
  • IgLON family member 2
  • IGLON2HNTNT
  • MGC60329
  • Neurotrimin
  • NTRI

Background

HNT - neurotrimin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33903
Species: Hu
Applications: IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
MAB4375
Species: Hu, Mu, Rt
Applications: IHC
NBP1-46535
Species: Hu, Mu, Rt, Rb, Xp, Ze
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB4077
Species: Hu
Applications: WB, IHC
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-47897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-35703
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS830
Species: Hu, Po, Bt, Ca, Eq, Mk, Pm, Rb
Applications: WB, IHC, IHC-P

Publications for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01) (0)

There are no publications for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01) (0)

There are no reviews for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Neurotrimin/HNT Products

Bioinformatics Tool for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01)

Discover related pathways, diseases and genes to Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01)

Discover more about diseases related to Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01).
 

Pathways for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01)

View related products by pathway.

PTMs for Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01)

Learn more about PTMs related to Neurotrimin/HNT Partial Recombinant Protein (H00050863-Q01).

Blogs on Neurotrimin/HNT

There are no specific blogs for Neurotrimin/HNT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BDNF [Unconjugated]
248-BD-005/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Neurotrimin/HNT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NTM
Entrez