Neuronal Pentraxin R/NPTXR Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Neuronal Pentraxin R/NPTXR Antibody - BSA Free (NBP3-10142) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of mouse Neuronal Pentraxin R/NPTXR. Peptide sequence VAQLPLSLKDSNWHHICISWTTRDGLWSAYQDGELRGSGENLAAWHPIKP |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NPTXR |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Theoretical MW |
52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Neuronal Pentraxin R/NPTXR Antibody - BSA Free
Background
The NPTXR gene encodes a protein similar to the rat neuronal pentraxin receptor. The rat pentraxin receptor is an integral membrane protein that is thought to mediate neuronal uptake of the snake venom toxin, taipoxin, and its transport into the synapses. Stud
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu
Applications: IHC
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: BA
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Publications for Neuronal Pentraxin R/NPTXR Antibody (NBP3-10142) (0)
There are no publications for Neuronal Pentraxin R/NPTXR Antibody (NBP3-10142).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Neuronal Pentraxin R/NPTXR Antibody (NBP3-10142) (0)
There are no reviews for Neuronal Pentraxin R/NPTXR Antibody (NBP3-10142).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Neuronal Pentraxin R/NPTXR Antibody (NBP3-10142) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Neuronal Pentraxin R/NPTXR Products
Blogs on Neuronal Pentraxin R/NPTXR