NeuroD2 Antibody - BSA Free

Western Blot: NeuroD2 Antibody [NBP3-10487] - Western blot analysis using NBP3-10487 on Human Cerebellum as a positive control. Antibody Titration: 0.2-1 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

NeuroD2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NeuroD2 (NP_006151). Peptide sequence PGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NEUROD2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for NeuroD2 Antibody - BSA Free

• BHLHA1
• bHLHa1neurogenic differentiation factor 2
• Class A basic helix-loop-helix protein 1
• MGC26304
• NDRF
• NDRFneurogenic basic-helix-loop-helix protein
• NeuroD2
• NeuroD-related factor
• neurogenic differentiation 2

Background

The NeuroD2 gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NEUROD2