NEURL2 Antibody

Images

 
Western Blot: NEURL2 Antibody [NBP1-70651] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NEURL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to NEURL2(neuralized homolog 2 (Drosophila)) The peptide sequence was selected form the middle region of NEURL2. Peptide sequence VEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NEURL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against NEURL2 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for NEURL2 Antibody

  • C20orf163
  • chromosome 20 open reading frame 163
  • dJ337O18.6
  • FLJ30259
  • MGC125934
  • MGC125935
  • neuralized homolog 2 (Drosophila)
  • neuralized-like 2 (Drosophila)
  • neuralized-like 2
  • neuralized-like protein 2
  • OZZ
  • Ozz-E3

Background

NEURL2 contains 1 NHR (neuralized homology repeat) domain and 1 SOCS box domain. NEURL2 plays an important role in the process of myofiber differentiation and maturation. NEURL2 is the probable substrate-recognition component of a SCF-like ECS (Elongin BC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90201
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-38412
Species: Hu
Applications: IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-56510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67632
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-1214
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00002023-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-70651
Species: Hu
Applications: WB

Publications for NEURL2 Antibody (NBP1-70651) (0)

There are no publications for NEURL2 Antibody (NBP1-70651).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEURL2 Antibody (NBP1-70651) (0)

There are no reviews for NEURL2 Antibody (NBP1-70651). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEURL2 Antibody (NBP1-70651) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for NEURL2 Antibody (NBP1-70651)

Discover related pathways, diseases and genes to NEURL2 Antibody (NBP1-70651). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEURL2 Antibody (NBP1-70651)

Discover more about diseases related to NEURL2 Antibody (NBP1-70651).
 

Pathways for NEURL2 Antibody (NBP1-70651)

View related products by pathway.

PTMs for NEURL2 Antibody (NBP1-70651)

Learn more about PTMs related to NEURL2 Antibody (NBP1-70651).

Blogs on NEURL2

There are no specific blogs for NEURL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEURL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NEURL2