Neurabin 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Neurabin 1 Antibody [NBP1-89857] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: Neurabin 1 Antibody [NBP1-89857] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells and in neuropil.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Neurabin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EEPCAESKAMPKSEIPSPQSQLLEDAEANLVGREAAKQQRKELAGGDFTSPDASASSCGKEVPEDSNNFDGSHVYMHSDYNVYRVRSRYNSDWGETGTEQDEEEDSDENSYYQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPP1R9A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Neurabin 1 Recombinant Protein Antigen (NBP1-89857PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Neurabin 1 Antibody

  • KIAA1222NRBI
  • neurabin-1
  • Neurabin-IFLJ20068
  • Neural tissue-specific F-actin-binding protein I
  • NRB1
  • Protein phosphatase 1 regulatory subunit 9A
  • protein phosphatase 1, regulatory (inhibitor) subunit 9A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6465
Species: Hu, Rt
Applications: WB, ICC
NLS1071
Species: Hu
Applications: IHC-P
NBP2-47624
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55379
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-49643
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15843
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP1-87232
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
NBP2-14290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-90105
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB3000
Species: Hu, Mu, Rt
Applications: WB
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-57636
Species: Hu
Applications: WB
NBP2-03512
Species: Hu, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-44050
Species: Mu, Rt
Applications: WB, PEP-ELISA
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA

Publications for Neurabin 1 Antibody (NBP1-89857) (0)

There are no publications for Neurabin 1 Antibody (NBP1-89857).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Neurabin 1 Antibody (NBP1-89857) (0)

There are no reviews for Neurabin 1 Antibody (NBP1-89857). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Neurabin 1 Antibody (NBP1-89857) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Neurabin 1 Products

Bioinformatics Tool for Neurabin 1 Antibody (NBP1-89857)

Discover related pathways, diseases and genes to Neurabin 1 Antibody (NBP1-89857). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Neurabin 1 Antibody (NBP1-89857)

Discover more about diseases related to Neurabin 1 Antibody (NBP1-89857).
 

Pathways for Neurabin 1 Antibody (NBP1-89857)

View related products by pathway.

Research Areas for Neurabin 1 Antibody (NBP1-89857)

Find related products by research area.

Blogs on Neurabin 1

There are no specific blogs for Neurabin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Neurabin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R9A