NEU2 Antibody (3B9)

Images

 
Western Blot: NEU2 Antibody (3B9) [H00004759-M03] - Analysis of NEU2 expression in human liver.
Western Blot: NEU2 Antibody (3B9) [H00004759-M03] - Analysis of NEU2 expression in human fetal liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3B9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NEU2 Antibody (3B9) Summary

Immunogen
NEU2 (NP_005374, 180 a.a. - 268 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
Specificity
NEU2 - sialidase 2 (cytosolic sialidase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NEU2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against tissue lysate and recombinant protein for WB. It has been used for ELISA.
Publications
Read Publications using H00004759-M03.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEU2 Antibody (3B9)

  • Cytosolic sialidase
  • EC 3.2.1.18
  • N-acetyl-alpha-neuraminidase 2
  • neuraminidase 2
  • SIAL2MGC129579
  • sialidase 2 (cytosolic sialidase)
  • sialidase-2

Background

This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

21630002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB6860
Species: Hu
Applications: WB, IP
AF3638
Species: Hu
Applications: WB
NBP2-32682
Species: Hu
Applications: IHC, IHC-P
NBP1-92177
Species: Hu
Applications: IHC, IHC-P
AF1049
Species: Hu
Applications: WB, IHC
NB100-240
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NB100-56566
Species: Hu, Mu, Rt, Po, Bv, Ma
Applications: WB, ChIP, DB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, B/N, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB100-56098
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for NEU2 Antibody (H00004759-M03)(2)

Reviews for NEU2 Antibody (H00004759-M03) (0)

There are no reviews for NEU2 Antibody (H00004759-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEU2 Antibody (H00004759-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NEU2 Products

Bioinformatics Tool for NEU2 Antibody (H00004759-M03)

Discover related pathways, diseases and genes to NEU2 Antibody (H00004759-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEU2 Antibody (H00004759-M03)

Discover more about diseases related to NEU2 Antibody (H00004759-M03).
 

Pathways for NEU2 Antibody (H00004759-M03)

View related products by pathway.

PTMs for NEU2 Antibody (H00004759-M03)

Learn more about PTMs related to NEU2 Antibody (H00004759-M03).

Blogs on NEU2

There are no specific blogs for NEU2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEU2 Antibody (3B9) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEU2
Entrez
OMIM
Uniprot