Nesprin 2 Recombinant Protein Antigen

Images

 
There are currently no images for Nesprin 2 Protein (NBP2-38620PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Nesprin 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SYNE2.

Source: E.coli

Amino Acid Sequence: GTTPPIEADTLDSSDAQGGLEPRVEKTRPEPTEVLHACKTQVAELELWLQQANVAVEPETLNADMQQVLEQQLVGCQAMLTEIEHKVAFLLETCKDQGLGDNGATQHEAEALSLKLKTVKCNLEKVQMMLQEKHSEDQ

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SYNE2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38620.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Nesprin 2 Recombinant Protein Antigen

  • DKFZP434H2235
  • DKFZp686E01115
  • DKFZp686H1931
  • EDMD5
  • FLJ46790
  • KIAA1011FLJ11014
  • nesprin 2
  • Nesprin-2
  • NUAFLJ43727
  • NUANCEFLJ45710
  • Nuclear envelope spectrin repeat protein 2
  • Nucleus and actin connecting element protein
  • polytrophin
  • Protein NUANCE
  • spectrin repeat containing, nuclear envelope 2
  • Synaptic nuclear envelope protein 2
  • synaptic nuclei expressed gene 2
  • SYNE-2
  • TROPH

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-75679
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-75696
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56649
Species: Hu
Applications: WB, ICC/IF, Flow-IC
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-67360
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49175
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IM, ICC, KD
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-38620PEP
Species: Hu
Applications: AC

Publications for Nesprin 2 Protein (NBP2-38620PEP) (0)

There are no publications for Nesprin 2 Protein (NBP2-38620PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nesprin 2 Protein (NBP2-38620PEP) (0)

There are no reviews for Nesprin 2 Protein (NBP2-38620PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Nesprin 2 Protein (NBP2-38620PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Nesprin 2 Products

Bioinformatics Tool for Nesprin 2 Protein (NBP2-38620PEP)

Discover related pathways, diseases and genes to Nesprin 2 Protein (NBP2-38620PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nesprin 2 Protein (NBP2-38620PEP)

Discover more about diseases related to Nesprin 2 Protein (NBP2-38620PEP).
 

Pathways for Nesprin 2 Protein (NBP2-38620PEP)

View related products by pathway.

PTMs for Nesprin 2 Protein (NBP2-38620PEP)

Learn more about PTMs related to Nesprin 2 Protein (NBP2-38620PEP).

Blogs on Nesprin 2

There are no specific blogs for Nesprin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Nesprin 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNE2