Recombinant Human Nesprin 2 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Nesprin 2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 6702-6799 of Human Nesprin 2

Source: Wheat Germ

Amino Acid Sequence: CRRELMQLEKELVERQPQVDMLQEISNSLLIKGHGEDCIEAEEKVHVIEKKLKQLREQVSQDLMALQGTQNPASPLPSFDEVDSGDQPPATSVPAPRA

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SYNE2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Nesprin 2 Protein

  • DKFZP434H2235
  • DKFZp686E01115
  • DKFZp686H1931
  • EDMD5
  • FLJ46790
  • KIAA1011FLJ11014
  • nesprin 2
  • Nesprin-2
  • NUAFLJ43727
  • NUANCEFLJ45710
  • Nuclear envelope spectrin repeat protein 2
  • Nucleus and actin connecting element protein
  • polytrophin
  • Protein NUANCE
  • spectrin repeat containing, nuclear envelope 2
  • Synaptic nuclear envelope protein 2
  • synaptic nuclei expressed gene 2
  • SYNE-2
  • TROPH

Background

SYNE2 - spectrin repeat containing, nuclear envelope 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59946
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-87692
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-59942
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-85550
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87396
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-06590
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-88691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-91273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84020
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-49175
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-241
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-P, IM, ICC
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
AF5745
Species: Hu
Applications: WB, IHC
H00023224-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Nesprin 2 Partial Recombinant Protein (H00023224-Q01) (0)

There are no publications for Nesprin 2 Partial Recombinant Protein (H00023224-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Nesprin 2 Partial Recombinant Protein (H00023224-Q01) (0)

There are no reviews for Nesprin 2 Partial Recombinant Protein (H00023224-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Nesprin 2 Partial Recombinant Protein (H00023224-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Nesprin 2 Products

Bioinformatics Tool for Nesprin 2 Partial Recombinant Protein (H00023224-Q01)

Discover related pathways, diseases and genes to Nesprin 2 Partial Recombinant Protein (H00023224-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Nesprin 2 Partial Recombinant Protein (H00023224-Q01)

Discover more about diseases related to Nesprin 2 Partial Recombinant Protein (H00023224-Q01).
 

Pathways for Nesprin 2 Partial Recombinant Protein (H00023224-Q01)

View related products by pathway.

PTMs for Nesprin 2 Partial Recombinant Protein (H00023224-Q01)

Learn more about PTMs related to Nesprin 2 Partial Recombinant Protein (H00023224-Q01).

Blogs on Nesprin 2

There are no specific blogs for Nesprin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Nesprin 2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNE2