Nephronophthisis Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to NPHP1(nephronophthisis 1 (juvenile)) The peptide sequence was selected from the middle region of NPHP1.
Peptide sequence GILFELGISYIRNSTGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGG. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
NPHP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Nephronophthisis Antibody - BSA Free
Background
Together with Cas NPHP1 may play a role in the control of epithelial cell polarity. NPHP1 seems to help to recruit protein tyrosine kinase 2 beta (PTK2B) to cell matrix adhesions, thereby initiating phosphorylation of PTK2B and PTK2B-dependent signaling.This gene encodes a protein with src homology domain 3 (SH3) patterns. This protein interacts with Crk-associated substrate, and it appears to function in the control of cell division, as well as in cell-cell and cell-matrix adhesion signaling, likely as part of a multifunctional complex localized in actin- and microtubule-based structures. Mutations in this gene cause familial juvenile nephronophthisis type 1, a kidney disorder involving both tubules and glomeruli. Defects in this gene are also associated with Senior-Loken syndrome type 1, also referred to as juvenile nephronophthisis with Leber amaurosis, which is characterized by kidney and eye disease, and with Joubert syndrome type 4, which is characterized by cerebellar ataxia, oculomotor apraxia, psychomotor delay and neonatal breathing abnormalities, sometimes including retinal dystrophy and renal disease. Multiple transcript variants encoding different isoforms have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu
Applications: ICC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IP, WB
Species: Hu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Publications for Nephronophthisis Antibody (NBP1-59110) (0)
There are no publications for Nephronophthisis Antibody (NBP1-59110).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Nephronophthisis Antibody (NBP1-59110) (0)
There are no reviews for Nephronophthisis Antibody (NBP1-59110).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Nephronophthisis Antibody (NBP1-59110) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Nephronophthisis Products
Research Areas for Nephronophthisis Antibody (NBP1-59110)
Find related products by research area.
|
Blogs on Nephronophthisis