NELL2 Antibody (1F6)

Images

 
Sandwich ELISA: NELL2 Antibody (1F6) [H00004753-M04] - Detection limit for recombinant GST tagged NELL2 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NELL2 Antibody (1F6) Summary

Immunogen
NELL2 (NP_006150.1 301 a.a. - 400 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVYSSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDF
Specificity
NELL2 - NEL-like 2 (chicken) (1F6)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NELL2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NELL2 Antibody (1F6)

  • Mel91
  • nel (chicken)-like 2
  • NELL2
  • NEL-like 2 (chicken)
  • NEL-like protein 2
  • Nel-related protein 2
  • NRP2
  • NRP2neural epidermal growth factor-like 2
  • protein kinase C-binding protein NELL2

Background

The protein encoded by this gene is a glycoprotein containing several von Willebrand factor C domains and epidermal growth factor (EGF)-like domains. The encoded protein acts as a homotrimer and is found in the cytoplasm. Several variants encoding a few different isoforms exist, and at least one isoform appears to be a secreted protein. Studies in mouse suggest that this protein plays a role in neural cell growth and differentiation as well as in oncogenesis. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF566
Species: Mu, Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
AF7109
Species: Mu
Applications: WB, IHC
NBP1-81162
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84682
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4075
Species: Mu, Rt
Applications: WB, IHC
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-31551
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P

Publications for NELL2 Antibody (H00004753-M04) (0)

There are no publications for NELL2 Antibody (H00004753-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NELL2 Antibody (H00004753-M04) (0)

There are no reviews for NELL2 Antibody (H00004753-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NELL2 Antibody (H00004753-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NELL2 Products

Bioinformatics Tool for NELL2 Antibody (H00004753-M04)

Discover related pathways, diseases and genes to NELL2 Antibody (H00004753-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NELL2 Antibody (H00004753-M04)

Discover more about diseases related to NELL2 Antibody (H00004753-M04).
 

Pathways for NELL2 Antibody (H00004753-M04)

View related products by pathway.

PTMs for NELL2 Antibody (H00004753-M04)

Learn more about PTMs related to NELL2 Antibody (H00004753-M04).

Blogs on NELL2

There are no specific blogs for NELL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NELL2 Antibody (1F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NELL2
Entrez
Uniprot