NELF-E Recombinant Protein Antigen

Images

 
There are currently no images for NELF-E Recombinant Protein Antigen (NBP2-55487PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NELF-E Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NELF-E.

Source: E.coli

Amino Acid Sequence: VYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVYKE

Protein/Peptide Type
Recombinant Protein Antigen
Gene
RDBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55487 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NELF-E Recombinant Protein Antigen

  • D6S45
  • negative elongation factor E
  • negative elongation factor polypeptide E
  • NELFE
  • NELF-ERDmajor histocompatibility complex gene RD
  • nuclear protein
  • RD RNA binding protein
  • RD RNA-binding protein
  • RDP
  • RNA-binding protein RD

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-80849
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88116
Species: Hu
Applications: IHC, IHC-P
H00005555-P01
Species: Hu
7270-IL/CF
Species: Hu
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
MAB2358
Species: Hu, Mu
Applications: IHC, ICC

Publications for NELF-E Recombinant Protein Antigen (NBP2-55487PEP) (0)

There are no publications for NELF-E Recombinant Protein Antigen (NBP2-55487PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NELF-E Recombinant Protein Antigen (NBP2-55487PEP) (0)

There are no reviews for NELF-E Recombinant Protein Antigen (NBP2-55487PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for NELF-E Recombinant Protein Antigen (NBP2-55487PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NELF-E Products

Bioinformatics Tool for NELF-E Recombinant Protein Antigen (NBP2-55487PEP)

Discover related pathways, diseases and genes to NELF-E Recombinant Protein Antigen (NBP2-55487PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NELF-E Recombinant Protein Antigen (NBP2-55487PEP)

Discover more about diseases related to NELF-E Recombinant Protein Antigen (NBP2-55487PEP).
 

Pathways for NELF-E Recombinant Protein Antigen (NBP2-55487PEP)

View related products by pathway.

Blogs on NELF-E

There are no specific blogs for NELF-E, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF
NELF-E Antibody
NBP1-88036
NELF-E Antibody
NBP1-88036
NELF-E Antibody
NBP1-88036

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NELF-E Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol RDBP