NEK2 Antibody (2F6)

Images

 
Western Blot: NEK2 Antibody (2F6) [H00004751-M01] - Analysis of NEK2 expression in transfected 293T cell line by NEK2 monoclonal antibody (M01), clone 2F6.Lane 1: NEK2 transfected lysate(51.8 KDa).Lane 2: ...read more
Immunohistochemistry-Paraffin: NEK2 Antibody (2F6) [H00004751-M01] - Analysis of monoclonal antibody to NEK2 on formalin-fixed paraffin-embedded human testis. Antibody concentration 1 ug/ml.
Immunoprecipitation: NEK2 Antibody (2F6) [H00004751-M01] - Analysis of NEK2 transfected lysate using anti-NEK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with NEK2 MaxPab rabbit polyclonal ...read more
Sandwich ELISA: NEK2 Antibody (2F6) [H00004751-M01] - Detection limit for recombinant GST tagged NEK2 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, IP, S-ELISA
Clone
2F6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

NEK2 Antibody (2F6) Summary

Immunogen
NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR
Specificity
NEK2 (2F6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NEK2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:2000
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEK2 Antibody (2F6)

  • EC 2.7.11
  • EC 2.7.11.1
  • HSPK 21
  • HsPK21
  • NEK2
  • NEK2AHsPK21
  • Never in mitosis A-related kinase 2
  • NIMA (never in mitosis gene a)-related kinase 2
  • NimA-like protein kinase 1
  • NimA-related protein kinase 2
  • NLK1
  • NLK1serine/threonine-protein kinase Nek2

Background

Protein kinase that is involved in mitotic regulation. May have a role at the G2-M transition. May also play a role in meiosis. Isoform 1 but not isoform 2 appears to play a role in centrosome splitting. Isoform 1 phosphorylates and activates NEK11 in G1/S-arrested cells. Isoform 2, which is not present in the nucleolus, does not

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
H00011190-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-47865
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-338
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
H00091754-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-33466
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88795
Species: Hu
Applications: IHC, IHC-P, WB
AF6000
Species: Hu, Mu
Applications: IHC, Simple Western, WB
NBP1-82884
Species: Hu, Mu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP1-80820
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-48017
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB

Publications for NEK2 Antibody (H00004751-M01) (0)

There are no publications for NEK2 Antibody (H00004751-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK2 Antibody (H00004751-M01) (0)

There are no reviews for NEK2 Antibody (H00004751-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEK2 Antibody (H00004751-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NEK2 Products

Bioinformatics Tool for NEK2 Antibody (H00004751-M01)

Discover related pathways, diseases and genes to NEK2 Antibody (H00004751-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEK2 Antibody (H00004751-M01)

Discover more about diseases related to NEK2 Antibody (H00004751-M01).
 

Pathways for NEK2 Antibody (H00004751-M01)

View related products by pathway.

PTMs for NEK2 Antibody (H00004751-M01)

Learn more about PTMs related to NEK2 Antibody (H00004751-M01).
 

Research Areas for NEK2 Antibody (H00004751-M01)

Find related products by research area.

Blogs on NEK2

There are no specific blogs for NEK2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEK2 Antibody (2F6) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK2
Entrez
OMIM
Uniprot