We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

NEK1 Recombinant Protein Antigen

Images

 
There are currently no images for NEK1 Protein (NBP1-82883PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NEK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEK1.

Source: E. coli

Amino Acid Sequence: VLKEQLERKRKEAYEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQKTNNAISSKR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NEK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82883.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NEK1 Recombinant Protein Antigen

  • DKFZp686D06121
  • DKFZp686K12169
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA1901MGC138800
  • Never in mitosis A-related kinase 1
  • NIMA (never in mitosis gene a)-related kinase 1
  • NimA-related protein kinase 1
  • NY-REN-55
  • protein-serine/threonine kinase
  • Renal carcinoma antigen NY-REN-55
  • serine/threonine-protein kinase Nek1
  • SRPS2

Background

Belonging to the NEK Ser/Thr protein kinase family, NEK1 plays an important role in the cell by responding to DNA damage. Molecular functions for NEK1 include protein serine/threonine kinase activity, protein tyrosine kinase activity, protein binding and ATP binding. More specifically, NEK1 is involved in cell cycle regulation, and the protein encoded by this gene is a serine/threonine kinase which is found in a centrosomal complex with FEZ1. Additionally, NEK1 also appears to possess tyrosine kinase activity and is involved in the control of meiosis and cilium assembly. NEK1 is known to interact with FEZ1, FEZ2, KIF3A, TSC2 and MRE11A. Common diseases for NEK1 include adenocarcinoma, cancer, short rib-polydactyly syndrome II and epithelial neoplasia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
H00004751-M11
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-47865
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
H00091754-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
236-EG
Species: Hu
Applications: BA
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, Simple Western, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-20401
Species: Hu
Applications: IHC,  IHC-P, WB
AF23151
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB600-717
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, RIA, RI, WB
291-G1
Species: Hu
Applications: BA
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-93834
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-42686
Species: Hu
Applications: IHC, IP, WB (-)
NBP2-38437
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for NEK1 Protein (NBP1-82883PEP) (0)

There are no publications for NEK1 Protein (NBP1-82883PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEK1 Protein (NBP1-82883PEP) (0)

There are no reviews for NEK1 Protein (NBP1-82883PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NEK1 Protein (NBP1-82883PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NEK1 Products

Array NBP1-82883PEP

Research Areas for NEK1 Protein (NBP1-82883PEP)

Find related products by research area.

Blogs on NEK1

There are no specific blogs for NEK1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NEK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NEK1