NEDP1/SENP8 Antibody

Images

 
Western Blot: NEDP1/SENP8 Antibody [H00123228-D01P] - Analysis of SENP8 expression in human liver.
Western Blot: NEDP1/SENP8 Antibody [H00123228-D01P] - Analysis of SENP8 expression in transfected 293T cell line by SENP8 polyclonal antibody.Lane 1: SENP8 transfected lysate(24.10 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Product Discontinued
View other related NEDP1/SENP8 Primary Antibodies

Order Details


    • Catalog Number
      H00123228-D01P
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

NEDP1/SENP8 Antibody Summary

Immunogen
SENP8 (NP_660205.2, 1 a.a. - 212 a.a.) full-length human protein. MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKK
Specificity
SENP8 - SUMO/sentrin specific peptidase family member 8,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SENP8
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for NEDP1/SENP8 Antibody

  • DEN1
  • DEN1deneddylase-1
  • deneddylase 1
  • Deneddylase-1
  • EC 3.4.22.-
  • HsT17512
  • NEDD8-specific protease 1
  • NEDP1
  • NEDP1NEDD8 specific-protease cysteine 2
  • Protease, cysteine 2
  • protease, cysteine, 2 (NEDD8 specific)
  • PRSC2
  • SENP8
  • Sentrin/SUMO-specific protease SENP8
  • sentrin-specific protease 8
  • SUMO sentrin specific protease family member 8
  • SUMO/sentrin specific peptidase family member 8
  • SUMO/sentrin specific protease family member 8

Background

NEDD8 (MIM 603171) is a ubiquitin-like protein that becomes conjugated to the cullin (see CUL1; MIM 603134) subunit of several ubiquitin ligases. This conjugation, called neddylation, is required for optimal ubiquitin ligase activity. NEDD8-specific deneddylases, such as NEDP1, or DEN1, are required to process the NEDD8 propeptide at a C-terminal diglycine motif and to remove NEDD8 from cullins (Gan-Erdene et al., 2003 [PubMed 12759363]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

UL-812
Species: Hu
NBP2-75458
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-80408
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86037
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02648
Species: Hu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NB100-2736
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-83180
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010920-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
H00005688-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
NB110-92756
Species: Hu, Mu, Ch, Re
Applications: WB
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB120-11899
Species: Mu
Applications: WB, IHC, IHC-Fr

Publications for NEDP1/SENP8 Antibody (H00123228-D01P) (0)

There are no publications for NEDP1/SENP8 Antibody (H00123228-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDP1/SENP8 Antibody (H00123228-D01P) (0)

There are no reviews for NEDP1/SENP8 Antibody (H00123228-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NEDP1/SENP8 Antibody (H00123228-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional NEDP1/SENP8 Products

Bioinformatics Tool for NEDP1/SENP8 Antibody (H00123228-D01P)

Discover related pathways, diseases and genes to NEDP1/SENP8 Antibody (H00123228-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NEDP1/SENP8 Antibody (H00123228-D01P)

Discover more about diseases related to NEDP1/SENP8 Antibody (H00123228-D01P).
 

Pathways for NEDP1/SENP8 Antibody (H00123228-D01P)

View related products by pathway.

PTMs for NEDP1/SENP8 Antibody (H00123228-D01P)

Learn more about PTMs related to NEDP1/SENP8 Antibody (H00123228-D01P).

Blogs on NEDP1/SENP8

There are no specific blogs for NEDP1/SENP8, but you can read our latest blog posts.
Coronavirus Brochure

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NEDP1/SENP8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SENP8
Entrez
Uniprot