NEDD8 Recombinant Protein Antigen

Images

 
There are currently no images for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

NEDD8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NEDD8.

Source: E. coli

Amino Acid Sequence: TLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NEDD8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68600.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NEDD8 Recombinant Protein Antigen

  • FLJ43224
  • MGC104393
  • MGC125896
  • MGC125897
  • NEDD8
  • NEDD-8
  • Neddylin
  • Neural precursor cell expressed developmentally down-regulated protein 8
  • neural precursor cell expressed, developmentally down-regulated 8
  • Rub1
  • Ubiquitin-like protein Nedd8

Background

NEDD8 (Neural precursor cell-Expressed Developmentally Down-regulated genes) is an ubiquitin-like protein which plays an important role in cell cycle control and embryogenesis (1). NEDD8 has been shown to conjugate to nuclear proteins in a manner analogous to ubiquination and sentrinization. The conjugation process is though to be catalyzed by thee enzymes; E1 (NEDD8-activation), E2 (NEDD8-conjugation) and E3 (NEDD8-ligation). NEDD8 is known to conjugate to Cul-4A and other cullins proteins via the carboxy-terminal Gly residue for ubiquitinylation (3) while NUB1 will negatively regulate its expression (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-16092
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
H00143384-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
255-SC
Species: Hu
Applications: BA
NBP3-35268
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
E2-656
Species: Hu, Mu, Rt
Applications: EnzAct
NBP3-21835
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IP, WB
NB120-495
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-48628
Species: Hu
Applications: IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF2769
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
H00055832-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB

Publications for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP) (0)

There are no publications for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP) (0)

There are no reviews for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NEDD8 Products

Research Areas for NEDD8 Recombinant Protein Antigen (NBP2-68600PEP)

Find related products by research area.

Blogs on NEDD8.

PINK1: All work and no fun
The protein PINK1 is a mitochondrial-located serine/threonine kinase (PTK) that maintains organelle function and integrity. It not only protects organelles from cellular stress, but it also uses the selective auto-phagocytosis process for cleaning and...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NEDD8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NEDD8