Recombinant Human NECAB3 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human NECAB3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-362 of Human NECAB3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
NECAB3

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NECAB3 Protein

  • Amyloid beta A4 protein-binding family A member 2-binding protein
  • APBA2BPfamily A, member 2 binding protein
  • dJ63M2.4
  • dJ63M2.5
  • EFCBP3STIP3
  • EF-hand calcium binding protein 3
  • Neuronal calcium-binding protein 3
  • neuronal calcium-binding protein NECAB3
  • NIP1Nek2-interacting protein 1
  • N-terminal EF-hand calcium binding protein 3
  • N-terminal EF-hand calcium-binding protein 3
  • synaptotagmin interacting protein 2
  • synaptotagmin interacting protein STIP3
  • SYTIP2
  • XB51X11L-binding protein 51

Background

The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86184
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
NBP2-00702
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-18891
Species: Hu, Mu
Applications: WB, IP
NB100-56150
Species: Hu, Rt, Po, Ch, Xp, Mu(-)
Applications: WB, IHC, IHC-P, IP
NBP2-30725
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
NB100-511
Species: Hu, Mu, Rt
Applications: WB, IP
NBP1-81804
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP1-84004
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41182
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00004751-M11
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-84002
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-93521
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00063941-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for NECAB3 Recombinant Protein (H00063941-P01) (0)

There are no publications for NECAB3 Recombinant Protein (H00063941-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NECAB3 Recombinant Protein (H00063941-P01) (0)

There are no reviews for NECAB3 Recombinant Protein (H00063941-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NECAB3 Recombinant Protein (H00063941-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NECAB3 Products

Bioinformatics Tool for NECAB3 Recombinant Protein (H00063941-P01)

Discover related pathways, diseases and genes to NECAB3 Recombinant Protein (H00063941-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NECAB3 Recombinant Protein (H00063941-P01)

Discover more about diseases related to NECAB3 Recombinant Protein (H00063941-P01).
 

Pathways for NECAB3 Recombinant Protein (H00063941-P01)

View related products by pathway.

PTMs for NECAB3 Recombinant Protein (H00063941-P01)

Learn more about PTMs related to NECAB3 Recombinant Protein (H00063941-P01).
 

Research Areas for NECAB3 Recombinant Protein (H00063941-P01)

Find related products by research area.

Blogs on NECAB3

There are no specific blogs for NECAB3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NECAB3 Antibody
NBP2-55136
BNIP3 Antibody
NB100-56150

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NECAB3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol NECAB3