NECAB3 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

NECAB3 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NECAB3.
  
  

  Source: E. coli

  Amino Acid Sequence: DGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYER

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: NECAB3
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68925.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NECAB3 Recombinant Protein Antigen

• Amyloid beta A4 protein-binding family A member 2-binding protein
• APBA2BPfamily A, member 2 binding protein
• dJ63M2.4
• dJ63M2.5
• EFCBP3STIP3
• EF-hand calcium binding protein 3
• Neuronal calcium-binding protein 3
• neuronal calcium-binding protein NECAB3
• NIP1Nek2-interacting protein 1
• N-terminal EF-hand calcium binding protein 3
• N-terminal EF-hand calcium-binding protein 3
• synaptotagmin interacting protein 2
• synaptotagmin interacting protein STIP3
• SYTIP2
• XB51X11L-binding protein 51

Background

NECAB3 is encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: NECAB3